(data stored in ACNUC7421 zone)

EMBL: CP001509.PE487

CP001509.PE487       Location/Qualifiers
FT   CDS_pept        complement(535913..536227)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECD_00489"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECD_00489"
FT                   /db_xref="EnsemblGenomes-Tr:ACT42388"
FT                   /protein_id="ACT42388.1"
FT                   /translation="MPVGRLHDNHGMHFSGSGLHILCAYACRHGTCSMTPQQENALRSI
FT                   ARQANSEIKKARQQFPDKNVDDICRSVLKKHRETVTLMGFTPTHLSLAIGMLNGVFKER
FT                   "
     ttgcccgtcg ggaggctgca tgacaaccac ggaatgcatt tttctggcag cgggcttcat        60
     attctgtgtg cttatgcttg ccgacatggg acttgttcaa tgacacctca gcaggaaaac       120
     gcccttcgca gcatagcccg tcaggctaat tctgaaatca aaaaagccag acagcagttt       180
     ccggataaaa acgtcgatga catttgccgt agcgtactga agaagcaccg cgaaacggta       240
     acgctgatgg gattcacacc gactcattta agcctggcga tcggcatgtt aaacggcgtc       300
     tttaaggagc gatga                                                        315
//

If you have problems or comments...

PBIL Back to PBIL home page