(data stored in ACNUC7421 zone)

EMBL: CP001509.PE506

CP001509.PE506       Location/Qualifiers
FT   CDS_pept        complement(547428..547622)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECD_00510"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECD_00510"
FT                   /db_xref="EnsemblGenomes-Tr:ACT42407"
FT                   /protein_id="ACT42407.1"
FT                   /translation="MSTKNRTRRTTTRNIRFPNQMIEQINIALEQKGSGNFSAWVIEAC
FT                   RRRLTSEKRAYTSIQSDDE"
     atgtcaacta agaacagaac ccgcagaaca acaacccgca acatccgctt tcctaaccaa        60
     atgattgaac aaattaacat cgctcttgag caaaaagggt ctgggaattt ctcagcctgg       120
     gtcattgaag cctgccgtcg gagactaacg tcagaaaaga gagcatatac atcaatccag       180
     agtgatgatg aataa                                                        195
//

If you have problems or comments...

PBIL Back to PBIL home page