(data stored in ACNUC7421 zone)

EMBL: CP001509.PE508

CP001509.PE508       Location/Qualifiers
FT   CDS_pept        550550..551146
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECD_00513"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECD_00513"
FT                   /db_xref="EnsemblGenomes-Tr:ACT42409"
FT                   /protein_id="ACT42409.1"
FT                   /translation="MAVQISGVLKDGAGKPIQNCTIQLKAKRNSTTVLVNTVASENPDE
FT                   AGRYSMDVEHGQYSVTLLVEGFPPSHAGTITVYEGSRPGTLNDFLGAMTEDDVMPEALR
FT                   RFEAMVEEAARNAEAASQSAAAAKKSETAAASSKNAAKTSETNAATASGFCRSPRVQTR
FT                   SPRLSPGAVLHRPAISSGRPFCPAPAQIQGRETAG"
     atggcagtac agatttcagg tgtgctgaaa gatggtgcgg gaaaaccaat acagaactgc        60
     actattcaac tgaaggcaaa gcgtaacagc accacggtac tggtgaacac ggtggcctct       120
     gaaaatccgg atgaagccgg gcgttacagc atggatgttg agcatggcca gtacagcgtc       180
     accctgctgg ttgaaggttt tccgccttca catgccggaa ccattaccgt ctatgaaggt       240
     tccagaccag gtacgctgaa tgattttctc ggtgccatga cggaagatga tgtcatgccg       300
     gaggcattgc gtcgttttga ggcaatggtg gaagaagcgg cacgcaacgc cgaagccgcc       360
     tctcagagcg cagcggcggc aaagaaatcc gaaactgcag cggcatcatc gaagaacgcg       420
     gcgaaaacct cagaaacgaa tgcagctaca gcatctggtt tttgtcgttc tccccgagtt       480
     caaaccaggt caccacgcct ttcacccggc gctgtacttc atcgccctgc catatcgtca       540
     ggtaggccat tttgtccagc acctgcgcaa attcaaggga gagaaactgc tggctga          597
//

If you have problems or comments...

PBIL Back to PBIL home page