(data stored in ACNUC7421 zone)

EMBL: CP001509.PE509

CP001509.PE509       Location/Qualifiers
FT   CDS_pept        complement(550995..551267)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECD_00530"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECD_00530"
FT                   /db_xref="EnsemblGenomes-Tr:ACT42410"
FT                   /protein_id="ACT42410.1"
FT                   /translation="MSTGLRFTLEVDGLPPDAFAVVSFHLNQSLSSLFSLDLSLVSQQF
FT                   LSLEFAQVLDKMAYLTIWQGDEVQRRVKGVVTWFELGENDKNQML"
     atgtcaaccg gattacgttt cacactggaa gtggacggcc tgccgccgga tgcttttgcg        60
     gtggtttcct ttcatctgaa ccagtcactc tcttcgctct tttccctcga tctctccctg       120
     gtcagccagc agtttctctc ccttgaattt gcgcaggtgc tggacaaaat ggcctacctg       180
     acgatatggc agggcgatga agtacagcgc cgggtgaaag gcgtggtgac ctggtttgaa       240
     ctcggggaga acgacaaaaa ccagatgctg tag                                    273
//

If you have problems or comments...

PBIL Back to PBIL home page