(data stored in ACNUC7421 zone)

EMBL: CP001509.PE599

CP001509.PE599       Location/Qualifiers
FT   CDS_pept        647213..649090
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECD_00624"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECD_00624"
FT                   /db_xref="EnsemblGenomes-Tr:ACT42500"
FT                   /protein_id="ACT42500.1"
FT                   /translation="MSASSVKPLNVQLPAITLILFALCVGIFCYLAQWMSYEEVDQSAL
FT                   IHLGANVASLSLSGEPWRLLSSVFLHSSFSHLLMNMFALLVVGAVTERILGKWRLLIIW
FT                   LFSGVFGGLISACYALRDSDQIVISVGASGAIMGIAGAAIATQLASGTGTHHKNQRRVF
FT                   PLLGMVALTLLYGARQTGIDNACHIGGLIAGGALGWLSARLSGQNRLVTEGGIIVAGSL
FT                   LLTGAIWLAQQQMDESVLQVRQSLREEFYPQEIEQERRQKKQQLAEERNALRETLSAPV
FT                   SREQASGDLLAEIADIHDMAISRDGNTLYAAIENTNSIVVFDLGQKKILHTFTAPIAKE
FT                   KSVKHCGGCKDQGVRSLTLSPDETLLYATSFEANALSVINVATGEIIQSITTGAHPDSL
FT                   ILSRDGTKAWVMNRTSNSVSAIDLVAYQHVADIPLEKYDGTGTSNKPGAWVMALSPDEK
FT                   ILLIPGMVRGDIVRINTITHQKEDFPAGDARGTISAMRFRPENGDVIFADSQGISRIRV
FT                   GDQQASIMTQWCSRSVYSVEGISPDGQYLALVSYGLQGYVILLNINVGQIVGVYPASYV
FT                   NHLRFSADGRKIFVMAKNGLIQMDRTLSLDPQAVIRHPQYGNVACIPEP"
     atgtctgcat cttcggttaa gccgttaaat gttcaattac ccgcaataac ccttatcctt        60
     tttgcgctct gtgttgggat attttgttac ctcgcacaat ggatgagtta tgaagaagtc       120
     gatcaatccg cactcatcca tctcggtgct aacgttgctt cactctcgtt gtcgggtgaa       180
     ccctggcgct tattgagcag tgtctttctg cacagtagtt tttcccattt gctgatgaat       240
     atgtttgcac tcctggtggt gggggcagtg acggaacgga tactggggaa atggcgactt       300
     ctgattattt ggttattctc cggcgtcttt ggtgggctca tcagcgcctg ttatgcgtta       360
     cgcgatagtg atcagatagt catcagcgtt ggggcatccg gggcaattat gggaatagct       420
     ggcgctgcga tagcaacaca gcttgcttca ggtacgggca cacaccataa aaaccagcgg       480
     cgagtatttc ctctgttggg tatggtggcg ctgacactgt tgtacggtgc ccggcaaaca       540
     ggaatagata acgcttgcca cattggcggc ctgattgcgg gtggcgcgtt gggttggctg       600
     agcgcgcgtt tatctgggca aaaccgactc gttacggaag gcgggattat tgttgcgggc       660
     agtcttcttc tgaccggggc tatctggctt gcgcagcagc agatggatga gtcagtttta       720
     caggtcaggc aaagcctgcg tgaagagttt tatccgcagg agattgaaca agagcgacga       780
     caaaaaaaac aacagttagc ggaggaacgc aacgccctca gggaaacatt atccgctccg       840
     gtaagtcgtg aacaggccag tggtgatttg ctcgctgaga ttgccgatat ccatgatatg       900
     gcgatcagtc gggatggtaa tacgttgtat gccgcaattg aaaacaccaa cagcattgtt       960
     gttttcgacc tcggacaaaa gaaaatcctg cataccttta cagcccccat agcgaaagaa      1020
     aagtcagtca aacattgtgg tggctgtaaa gatcagggcg tcagatcgct gacgctaagc      1080
     ccggatgaaa cgttgcttta tgcgacttca tttgaagcga atgcgttatc ggtcattaac      1140
     gtggcgacgg gggagattat tcagtcgatt accaccggtg cacatcctga cagccttatc      1200
     ctctcgcgtg atggcacaaa agcctgggtg atgaatcgca ccagtaatag tgtgtcagcc      1260
     attgatctgg tggcttatca gcatgtggcg gatatcccgc tggagaaata cgacgggacg      1320
     gggacgagta ataaacctgg tgcctgggtt atggcacttt ccccggatga aaaaatattg      1380
     ttgatacccg gtatggtcag aggtgacatt gtacgcatca ataccatcac gcatcagaaa      1440
     gaagactttc ccgcaggtga tgcgcgtgga acgatatcgg cgatgcgttt tcgacctgaa      1500
     aacggggatg taatttttgc cgacagccag gggatttcac gtataagagt tggggatcag      1560
     caagccagca ttatgacgca atggtgtagc aggagcgttt attccgttga gggtattagc      1620
     ccggacggtc agtatttagc gttggtgtca tatggcttgc aaggttatgt catcctgctc      1680
     aatattaatg tcgggcagat tgttggcgtt tatcctgcca gctacgttaa tcaccttcgt      1740
     ttttcggcgg atggtagaaa gatatttgtt atggcgaaga acgggttaat ccaaatggac      1800
     aggacgctct cgcttgatcc gcaggcagtt attcgtcatc cccaatatgg caatgtggct      1860
     tgtatccctg aaccgtaa                                                    1878
//

If you have problems or comments...

PBIL Back to PBIL home page