(data stored in ACNUC7421 zone)

EMBL: CP001509.PE625

CP001509.PE625       Location/Qualifiers
FT   CDS_pept        680457..680714
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECD_00650"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECD_00650"
FT                   /db_xref="EnsemblGenomes-Tr:ACT42526"
FT                   /protein_id="ACT42526.1"
FT                   /translation="MQKPLPVRWLIIQGLTENEHCGIQAYACNTESQEDLYAEVPLVGR
FT                   LTGIEEVKVEAIAMSKLHNMSCPPYMGHSAAVIFHLIYLS"
     atgcagaaac ccttaccagt caggtggctg ataatacaag ggttaacaga gaatgagcac        60
     tgcggaatac aggcatatgc ctgtaataca gagagtcagg aagacctgta cgctgaagtg       120
     cccttagtcg gtagactaac gggcattgaa gaagtgaaag tcgaagctat tgcgatgagc       180
     aaacttcata atatgagttg tccgccttat atggggcata gtgcggctgt tattttccat       240
     ttaatttacc tttcctga                                                     258
//

If you have problems or comments...

PBIL Back to PBIL home page