(data stored in ACNUC7421 zone)

EMBL: CP001509.PE637

CP001509.PE637       Location/Qualifiers
FT   CDS_pept        693938..694213
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECD_00662"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECD_00662"
FT                   /db_xref="EnsemblGenomes-Tr:ACT42538"
FT                   /protein_id="ACT42538.1"
FT                   /translation="MILFTISHSVFGKENPVEILVNSREMALELSYVYIKYVYGKEKAE
FT                   FQKPYSITDDNNCWKIEGKQPKTLGGNFTILIAKKDGQVLHVIHTK"
     atgatattgt ttacaatatc acactcagta tttggaaaag aaaatccagt ggaaatttta        60
     gtaaatagtc gtgaaatggc tttggaatta tcatatgttt acattaaata tgtatacggg       120
     aaagaaaaag cagaatttca gaaaccatat agtattacag atgacaataa ttgttggaaa       180
     atcgagggaa aacaaccgaa gacgttagga ggaaatttta caatactaat agcgaaaaaa       240
     gatgggcaag tgttgcatgt aatacacaca aaataa                                 276
//

If you have problems or comments...

PBIL Back to PBIL home page