(data stored in ACNUC7421 zone)

EMBL: CP001509.PE638

CP001509.PE638       Location/Qualifiers
FT   CDS_pept        complement(694425..694703)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECD_00663"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECD_00663"
FT                   /db_xref="EnsemblGenomes-Tr:ACT42539"
FT                   /protein_id="ACT42539.1"
FT                   /translation="MLPVFRYGGAGSHKGKKFPAVRRPIVHDGNAPASIGYRSDNRVTC
FT                   RRIAYLMFILFHKPSVHIVIVKIQYIFADAVIQLHVGSAEYCSRYGQ"
     ttgcttcccg ttttccgata cggcggcgcg gggagtcata aaggtaagaa atttccagca        60
     gtacggcgtc ctattgttca cgatggtaat gcaccagcca gtattggcta tcgtagtgat       120
     aaccgtgtaa cctgccgccg catcgcgtat ctaatgttca ttcttttcca taaaccgtcc       180
     gtacacattg tgatagtaaa aatacaatac atcttcgctg atgcggttat tcagctgcat       240
     gtgggaagcg ccgaatactg ctcccggtat ggccagtaa                              279
//

If you have problems or comments...

PBIL Back to PBIL home page