(data stored in ACNUC7421 zone)

EMBL: CP001509.PE687

CP001509.PE687       Location/Qualifiers
FT   CDS_pept        complement(754239..754406)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECD_10006"
FT                   /product="hypothetical protein"
FT                   /note="similar to lambdap35"
FT                   /db_xref="EnsemblGenomes-Gn:ECD_10006"
FT                   /db_xref="EnsemblGenomes-Tr:ACT42588"
FT                   /protein_id="ACT42588.1"
FT                   /translation="MHFRVTGEWNGEPFNRVIEAENINDCYDHWMIWAQIAHADVTNIR
FT                   IEELKEHQAA"
     atgcacttcc gagtcacagg agaatggaat ggagagccat tcaacagagt tatcgaagcg        60
     gagaacatca acgactgcta cgaccactgg atgatatggg cgcagatagc acatgcagac       120
     gtaaccaata ttcgaattga agaactgaaa gaacaccaag ccgcctga                    168
//

If you have problems or comments...

PBIL Back to PBIL home page