(data stored in ACNUC7421 zone)

EMBL: CP001509.PE690

CP001509.PE690       Location/Qualifiers
FT   CDS_pept        complement(755960..756145)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECD_10009"
FT                   /product="hypothetical protein"
FT                   /note="similar to lambdap37; orf61"
FT                   /db_xref="EnsemblGenomes-Gn:ECD_10009"
FT                   /db_xref="EnsemblGenomes-Tr:ACT42591"
FT                   /protein_id="ACT42591.1"
FT                   /translation="MRETRYDNHGMHFSGSGLHILCAYACRHGTCSMTPQQENALRSIA
FT                   RQANSEIKKSQTAVSG"
     atgagagaga ccaggtatga caaccacgga atgcattttt ctggcagcgg gcttcatatt        60
     ctgtgtgctt atgcttgccg acatgggact tgttcaatga cacctcagca ggaaaacgcc       120
     cttcgcagca ttgcccgtca ggctaattct gaaatcaaaa aaagccagac agcagtttcc       180
     ggataa                                                                  186
//

If you have problems or comments...

PBIL Back to PBIL home page