(data stored in ACNUC7421 zone)

EMBL: CP001509.PE691

CP001509.PE691       Location/Qualifiers
FT   CDS_pept        complement(756126..756317)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECD_10010"
FT                   /product="hypothetical protein"
FT                   /note="similar to lambdap38; orf63"
FT                   /db_xref="EnsemblGenomes-Gn:ECD_10010"
FT                   /db_xref="EnsemblGenomes-Tr:ACT42592"
FT                   /protein_id="ACT42592.1"
FT                   /translation="MHKASSVELRTSIEMAHSLAQIGIRFVPIPVETDEEFHTLAASLS
FT                   QKLEMMVAKAEADERDQV"
     atgcacaaag catcttctgt tgagttaaga acgagtatcg agatggcaca tagccttgct        60
     caaattggaa tcaggtttgt gccaatacca gtagaaacag acgaagaatt tcatacgtta       120
     gccgcatccc tttcacaaaa gctggaaatg atggtggcga aagcagaagc agatgagaga       180
     gaccaggtat ga                                                           192
//

If you have problems or comments...

PBIL Back to PBIL home page