(data stored in ACNUC7421 zone)

EMBL: CP001509.PE713

CP001509.PE713       Location/Qualifiers
FT   CDS_pept        complement(766432..766725)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECD_10032"
FT                   /product="Bor protein precursor"
FT                   /note="similar to lambdap77"
FT                   /db_xref="EnsemblGenomes-Gn:ECD_10032"
FT                   /db_xref="EnsemblGenomes-Tr:ACT42614"
FT                   /protein_id="ACT42614.1"
FT                   /translation="MKKMLLATALALLITGCAQQTFTVQNKPAAVAPKETITHHFFVSG
FT                   IGQKKTVDAAKICGGAENVVKTETQQTFVNGLLGFITLGIYTPLEARVYCSK"
     atgaaaaaaa tgctactcgc tactgcgctg gccctgctta ttacaggatg tgctcaacag        60
     acgtttactg ttcaaaacaa accggcagca gtagcaccaa aggaaaccat cacccatcat       120
     ttcttcgttt ctggaattgg gcagaagaaa actgtcgatg cagctaaaat ttgtggcggc       180
     gcagaaaatg ttgttaaaac agaaacccag caaacattcg taaatggatt gctcggtttt       240
     attactttag gcatttatac tccgctggaa gcgcgtgtgt attgctcaaa ataa             294
//

If you have problems or comments...

PBIL Back to PBIL home page