(data stored in ACNUC7421 zone)

EMBL: CP001509.PE714

CP001509.PE714       Location/Qualifiers
FT   CDS_pept        complement(767015..767548)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECD_10033"
FT                   /product="putative envelope protein"
FT                   /note="similar to lambdap78"
FT                   /db_xref="EnsemblGenomes-Gn:ECD_10033"
FT                   /db_xref="EnsemblGenomes-Tr:ACT42615"
FT                   /protein_id="ACT42615.1"
FT                   /translation="MKTFLIFDINHQQNTRRSDQIETIKTIMQTTRPRITWKVLPMAQV
FT                   AIFKEIFDQVRKDLDCELFYSELKRHNVSHYIYYLATDNIHIVLENDNTVLIKGLKKVV
FT                   NVKFSRNTHLIETSYDRLKSREITFQQYRENLAKAGVFRWVTNIHEHKRYYYTFDNSLL
FT                   FTESIQNTTQIFPR"
     gtgaaaacat tcctaatatt tgacataaat catcaacaaa acacaaggag gtcagaccag        60
     attgaaacga taaaaacgat aatgcaaact acgcgccctc gtatcacatg gaaggtttta       120
     ccaatggctc aggttgccat ttttaaagaa atattcgatc aagtgcgaaa agatttagac       180
     tgtgaattgt tttattctga actaaaacgt cacaacgtct cacattatat ttactatcta       240
     gccacagata atattcacat cgtgttagaa aacgataaca ccgtgttaat aaaaggactt       300
     aaaaaggttg taaatgttaa attctcaaga aacacgcatc ttatagaaac gtcctatgat       360
     aggttgaaat caagagaaat cacatttcag caatacaggg aaaatcttgc taaagcagga       420
     gttttccgat gggttacaaa tatccatgaa cataaaagat attactatac ctttgataat       480
     tcattactat ttactgagag cattcagaac actacacaaa tctttccacg ctaa             534
//

If you have problems or comments...

PBIL Back to PBIL home page