(data stored in ACNUC7421 zone)

EMBL: CP001509.PE737

CP001509.PE737       Location/Qualifiers
FT   CDS_pept        788125..789330
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECD_10056"
FT                   /product="Tail fiber protein"
FT                   /note="similar to lambdap27; orf-401"
FT                   /db_xref="EnsemblGenomes-Gn:ECD_10056"
FT                   /db_xref="EnsemblGenomes-Tr:ACT42638"
FT                   /protein_id="ACT42638.1"
FT                   /translation="MAVKISGVLKDGTGKPVQNCTIQLKARRNSTTVVVNTVGSENPDE
FT                   AGRYSMDVEYGQYSVILQVDGFPPSHAGTITVYEDSQPGTLNDFLCAMTEDDARPEVLR
FT                   RLELMVEEVARNASVVAQSTADAKKSAGDASASAAQVAALVTDATDSARAASTSAGQAA
FT                   SSAQEASSGAEAASAKATEAEKSAAAAESSKNAAATSAGAAKTSETNAAASQQSAATSA
FT                   STAATKASEAATSARDAVASKEAAKSSETNASSSAGRAASSATAAENSARAAKTSETNA
FT                   RSSETAAERSASAAADAKTAAAGSASTASTKATEAAGSAVSASQSKSAAEAAAIRAENS
FT                   AKRAEDIASAVALEDADTTRKGIVQLSSATNSTSETLAATPKAVKVVMDETNRKAHWTV
FT                   RH"
     atggcagtaa agatttcagg agtcctgaaa gacggcacag gaaaaccggt acagaactgc        60
     accattcagc tgaaagccag acgtaacagc accacggtgg tggtgaacac ggtgggctca       120
     gagaatccgg atgaagccgg gcgttacagc atggatgtgg agtacggtca gtacagtgtc       180
     atcctgcagg ttgacggttt tccaccatcg cacgccggga ccatcaccgt gtatgaagat       240
     tcacaaccgg ggacgctgaa tgattttctc tgtgccatga cggaggatga tgcccggccg       300
     gaggtgctgc gtcgtcttga actgatggtg gaagaggtgg cgcgtaacgc gtccgtggtg       360
     gcacagagta cggcagacgc gaagaaatca gccggcgatg ccagtgcatc agctgctcag       420
     gtcgcggccc ttgtgactga tgcaactgac tcagcacgcg ccgccagcac gtccgccgga       480
     caggctgcat cgtcagctca ggaagcgtcc tccggcgcag aagcggcatc agcaaaggcc       540
     actgaagcgg aaaaaagtgc cgcagccgca gagtcctcaa aaaacgcggc ggccaccagt       600
     gccggtgcgg cgaaaacgtc agaaacgaat gctgcagcgt cacaacaatc agccgccacg       660
     tctgcctcca ccgcggccac gaaagcgtca gaggccgcca cttcagcacg agatgcggtg       720
     gcctcaaaag aggcagcaaa atcatcagaa acgaacgcat catcaagtgc cggtcgtgca       780
     gcttcctcgg caacggcggc agaaaattct gccagggcgg caaaaacgtc cgagacgaat       840
     gccaggtcat ctgaaacagc agcggaacgg agcgcctctg ccgcggcaga cgcaaaaaca       900
     gcggcggcgg ggagtgcgtc aacggcatcc acgaaggcga cagaggctgc gggaagtgcg       960
     gtatcagcat cgcagagcaa aagtgcggca gaagcggcgg caatacgtgc agaaaattcg      1020
     gcaaaacgtg cagaagatat agcttcagct gtcgcgcttg aggatgcgga cacaacgaga      1080
     aaggggatag tgcagctcag cagtgcaacc aacagcacgt ctgaaacgct tgctgcaacg      1140
     ccaaaggcgg ttaaggtggt aatggatgaa acgaacagaa aagcccactg gacagtccgg      1200
     cactga                                                                 1206
//

If you have problems or comments...

PBIL Back to PBIL home page