(data stored in ACNUC7421 zone)

EMBL: CP001509.PHOR

CP001509.PHOR        Location/Qualifiers
FT   CDS_pept        383291..384586
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="phoR"
FT                   /locus_tag="ECD_00348"
FT                   /product="sensory histidine kinase in two-component
FT                   regulatory system with PhoB"
FT                   /EC_number="2.7.1.-"
FT                   /note="similar to b0400"
FT                   /db_xref="EnsemblGenomes-Gn:ECD_00348"
FT                   /db_xref="EnsemblGenomes-Tr:ACT42247"
FT                   /protein_id="ACT42247.1"
FT                   /translation="MLERLSWKRLVLELLLCCFPAFILGAFFGYLPWFLLASVTGLLIW
FT                   HFWNLLRLSWWLWVDRSMTPPPGRGSWEPLLYGLHQMQLRNKKRRRELGNLIKRFRSGA
FT                   ESLPDAVVLTTEEGGIFWCNGLAQQILGLRWPEDNGQNILNLLRYPEFTQYLKTRDFSR
FT                   PLNLVLNTGRHLEIRVMPYTHKQLLMVARDVTQMHQLEGARRNFFANVSHELRTPLTVL
FT                   QGYLEMMDEQPLEGAVREKALHTMREQTQRMEGLVKQLLTLSKIEAAPTQLLNEKVDVP
FT                   MMLRVVEREAQTLSQKKQTFTFEIDNGLKVSGNEDQLRSAISNLVYNAVNHTPEGTHIT
FT                   VRWLRVPHGAEFSVEDNGPGIAPEHIPRLTERFYRVDKARSRQTGGSGLGLAIVKHAVN
FT                   HHESRLNIESTVGKGTRFSFVIPERLIAKNSD"
     gtgctggaac ggctgtcgtg gaaaaggctg gtgctggagc tgctactttg ctgcttcccg        60
     gctttcatcc tgggtgcatt ttttggttac ctgccctggt ttttgctggc atcggtaacg       120
     ggactgctta tctggcattt ctggaattta ttgcgccttt catggtggct gtgggtggat       180
     cgtagtatga ccccgccacc ggggcgtggt agctgggaac cgctactata cggcttacac       240
     cagatgcagc tgcgaaataa aaaacgccgc cgtgaactgg gcaatctgat taaacgcttt       300
     cgtagcggcg cggagtcgct gcccgacgca gtggtgctga ccacggaaga gggcggtatt       360
     ttctggtgta acggtctggc gcaacaaatt cttggtttgc gctggccgga agataacggg       420
     cagaacatcc ttaacctgct gcgttacccg gagtttacgc aatatctgaa aacgcgtgat       480
     ttttctcgcc cgctcaatct ggtgctcaac accgggcggc atctggaaat tcgcgtcatg       540
     ccttataccc acaaacagtt gctgatggtg gcgcgtgatg tcacgcaaat gcatcaactg       600
     gaaggggcgc ggcgtaactt ttttgccaac gtgagccatg agttacgtac gccattgacc       660
     gtgttacagg gttacctgga gatgatggat gagcagccgc tggaaggcgc ggtacgcgaa       720
     aaagcgttgc acaccatgcg cgagcagacc cagcggatgg aagggctggt gaagcagttg       780
     ctaacgctgt cgaaaattga agccgcgccg acgcaattgc tcaatgaaaa ggttgatgtg       840
     ccgatgatgc tgcgcgttgt tgagcgcgag gctcagactc tgagtcagaa aaaacagaca       900
     tttacctttg agatagataa cggcctcaag gtgtctggca acgaagatca gctacgcagt       960
     gcgatttcga acctggtcta taacgccgtg aatcatacgc cggaaggcac gcatatcacc      1020
     gtacgctggc tgcgagtgcc gcacggtgcc gaatttagcg ttgaagataa cggaccgggc      1080
     attgcaccgg agcatattcc gcgcctgacc gagcgttttt atcgcgttga taaagcgcgt      1140
     tcccggcaaa ccggcggtag cggattaggg ttagcgatcg tgaaacatgc ggtgaatcat      1200
     cacgaaagtc gcctgaatat tgagagtaca gtaggaaaag gaacacgttt cagttttgtt      1260
     atcccggaac gtttaattgc caaaaacagc gattaa                                1296
//

If you have problems or comments...

PBIL Back to PBIL home page