(data stored in ACNUC7421 zone)

EMBL: CP001509.PRFH

CP001509.PRFH        Location/Qualifiers
FT   CDS_pept        258196..258696
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="prfH"
FT                   /locus_tag="ECD_00231"
FT                   /product="peptide chain release factor 2"
FT                   /note="similar to b0236"
FT                   /db_xref="EnsemblGenomes-Gn:ECD_00231"
FT                   /db_xref="EnsemblGenomes-Tr:ACT42130"
FT                   /protein_id="ACT42130.1"
FT                   /translation="MLETETGRYSDTLRSALVSLDGDNAWALSESWCGTIQWICPSPYR
FT                   PHHGRKNWFLGIGRFTADEKEQSDAIRYETLRSSGPGGQHVNKTDSAVRATHLASGISV
FT                   KVQSERSQHANKRLARLLIAWKLEQQQQENSAALKSQRRMFHHQIERGNPRRTFTGMAF
FT                   IEG"
     gtgctggaaa cagaaacggg ccgctactct gacacgctgc gttcggcgct ggtttctctg        60
     gatggcgata acgcatgggc attaagcgaa agctggtgtg gcactattca gtggatttgt       120
     ccgagtccgt atcggcctca tcatgggcgc aaaaactggt ttctgggcat tgggcgtttt       180
     accgctgatg agaaggaaca atcggatgca atccgttatg agacgctgcg ttcgtcgggg       240
     ccgggcggtc aacatgtcaa taaaaccgac tcggcggtac gcgccacgca tctggcatcc       300
     ggtattagcg tgaaggttca gtcagagcgc agccagcatg ctaacaaacg gctggcgcga       360
     ttgctgattg cctggaagct ggagcagcag caacaggaaa atagcgcggc gctgaaatcg       420
     cagcggcgaa tgttccatca ccagattgaa cgtggcaacc cgcgacggac atttacaggg       480
     atggctttta tcgaaggata a                                                 501
//

If you have problems or comments...

PBIL Back to PBIL home page