(data stored in ACNUC7421 zone)

EMBL: CP001509.PRIC

CP001509.PRIC        Location/Qualifiers
FT   CDS_pept        complement(459331..459858)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="priC"
FT                   /locus_tag="ECD_00418"
FT                   /product="primosomal replication protein N''"
FT                   /note="similar to b0467"
FT                   /db_xref="EnsemblGenomes-Gn:ECD_00418"
FT                   /db_xref="EnsemblGenomes-Tr:ACT42317"
FT                   /protein_id="ACT42317.1"
FT                   /translation="MKTALLLEKLEGQLATLRQRCAPVSQFATLSARFDRHLFQTRATT
FT                   LQACLDEAGDNLAALRHAVEQQQLPQVAWLAEHLAAQLEAIAREASAWSLREWDSAPPK
FT                   IARWQRKRIQHQDFERRLREMVAERRARLARVTDLVEQQTLHREVEAYEARLARCRHAL
FT                   EKIENRLARLTR"
     gtgaaaaccg ccctgctgct ggaaaaactg gaaggacagc tcgctacgct gcgtcagcgt        60
     tgtgccccgg tgtcacagtt cgccacgcta agtgctcgtt tcgacaggca tctttttcag       120
     actcgtgcga caacactaca ggcttgtctc gacgaggcgg gcgataatct ggctgcgctt       180
     cgtcatgcag ttgagcagca acagctgccg caagtggcct ggctggcgga acatctggcg       240
     gcacaactgg aagccatcgc gcgtgaagcc tccgcctggt cattgcgcga gtgggacagt       300
     gcaccaccga aaattgcccg ctggcagcgt aaacgtattc agcatcagga ttttgagcgg       360
     cggctacgtg agatggttgc cgaacgcaga gcccgtctgg cgcgggtgac cgatctcgtg       420
     gaacagcaaa cgctgcatcg tgaagtggaa gcctatgaag cgcgcctggc acgctgccgc       480
     catgcgctgg aaaaaatcga aaacaggtta gcgcgtttaa cccgctag                    528
//

If you have problems or comments...

PBIL Back to PBIL home page