(data stored in ACNUC7421 zone)

EMBL: CP001509.PROB

CP001509.PROB        Location/Qualifiers
FT   CDS_pept        264883..265986
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="proB"
FT                   /locus_tag="ECD_00239"
FT                   /product="gamma-glutamate kinase"
FT                   /EC_number="2.7.2.11"
FT                   /note="similar to b0242"
FT                   /db_xref="EnsemblGenomes-Gn:ECD_00239"
FT                   /db_xref="EnsemblGenomes-Tr:ACT42138"
FT                   /protein_id="ACT42138.1"
FT                   /translation="MSDSQTLVVKLGTSVLTGGSRRLNRAHIVELVRQCAQLHAAGHRI
FT                   VIVTSGAIAAGREHLGYPELPATIASKQLLAAVGQSRLIQLWEQLFSIYGIHVGQMLLT
FT                   RADMEDRERFLNARDTLRALLDNNIVPVINENDAVATAEIKVGDNDNLSALAAILAGAD
FT                   KLLLLTDQKGLYTADPRSNPQAELIKDVYGIDDALRAIAGDSVSGLGTGGMSTKLQAAD
FT                   VACRAGIDTIIAAGSKPGVIGDVMEGISVGTLFHAQATPLENRKRWIFGAPPAGEITVD
FT                   EGATAAILERGSSLLPKGIKSVTGNFSRGEVIRICNLEGRDIAHGVSRYNSDALRRIAG
FT                   HHSQEIDAILGYEYGPVAVHRDDMITR"
     atgagtgaca gccagacgct ggtggtaaaa ctcggcacca gtgtgctaac aggcggatcg        60
     cgccgtctga accgtgccca tatcgttgaa cttgttcgcc agtgcgcgca gttacatgcc       120
     gccgggcatc ggattgttat tgtgacgtcg ggcgcgatcg ccgccggacg tgagcacctg       180
     ggttacccgg aactgccagc gactatcgcc tcgaaacaac tgctggcggc ggtagggcag       240
     agtcgactga ttcaactgtg ggaacagctg ttttcgattt atggcattca cgtcgggcaa       300
     atgctgctga cccgtgctga tatggaagac cgagaacgct tcctgaacgc ccgcgacacc       360
     ctgcgtgcgt tgctcgataa caatatcgtt ccggtaatca atgagaacga tgctgtcgct       420
     acggcagaga ttaaggtcgg cgataacgat aacctttctg cgctggcggc gattctggcg       480
     ggtgccgata aactgttgct gctgaccgat caaaaaggtt tgtataccgc tgacccgcgc       540
     agcaatccgc aggcagaact gattaaagat gtttacggca ttgatgacgc actgcgcgcg       600
     attgccggtg acagcgtttc aggcctcgga actggcggca tgagtaccaa attgcaggcc       660
     gctgacgtgg cttgccgtgc gggtatcgac accattattg ccgcgggcag caagccgggc       720
     gttattggtg atgtgatgga aggcatttcc gtcggtacgc tgttccatgc ccaggcgact       780
     ccgcttgaaa accgtaaacg ctggattttc ggtgcgccgc cggcgggtga aatcacggta       840
     gatgaagggg caactgccgc cattctggaa cgcggcagct ccctgttgcc gaaaggcatt       900
     aaaagcgtga ctggcaattt ctcgcgtggt gaagtcatcc gcatttgcaa cctcgaaggc       960
     cgcgatatcg cccacggcgt cagtcgttac aacagcgatg cattacgccg tattgccgga      1020
     caccactcgc aagaaattga tgcaatactg ggatatgaat acggcccggt tgccgttcac      1080
     cgtgatgaca tgattacccg ttaa                                             1104
//

If you have problems or comments...

PBIL Back to PBIL home page