(data stored in ACNUC7421 zone)

EMBL: CP001509.PRPR

CP001509.PRPR        Location/Qualifiers
FT   CDS_pept        complement(316486..318072)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="prpR"
FT                   /locus_tag="ECD_00285"
FT                   /product="propionate catabolism operon regulatory protein"
FT                   /note="similar to b0330"
FT                   /db_xref="EnsemblGenomes-Gn:ECD_00285"
FT                   /db_xref="EnsemblGenomes-Tr:ACT42184"
FT                   /protein_id="ACT42184.1"
FT                   /translation="MAHPPRLNDDKPVIWTVSVTRLFELFRDISLEFDHLANITPIQLG
FT                   FEKAVTYIHKKLANERCDAIIAAGSNGAYLKSRLSVPVILIKPSGYDVLQALAKAGKLT
FT                   SSIGVVTYQETIPALVAFQKTFNLRLDQRSYITEEDARGQINELKANGTEAVVGAGLIT
FT                   DLAEEAGMTGIFIYSAATVRQAFSDALDMTRMSLRHNTHDATRNALRTRYVLGDMLGQS
FT                   PQMEQVRQTILLYARSSAAVLIEGETGTGKELAAQAIHREYFARHDARQGKKSHPFVAV
FT                   NCGAIAESLLEAELFGYEEGAFTGSRRGGRAGLFEIAHGGTLFLDEIGEMPLPLQTRLL
FT                   RVLEEKEVTRVGGHQPVPVDVRVISATHCNLEEDMRQGQFRRDLFYRLSILRLQLPPLR
FT                   ERVADILPLAESFLKVSLAALSTPFSAALRQGLQASETVLVHYDWPGNIRELRNMMERL
FT                   ALFLSVEPTPDLTPQFLQLLLPELARESAKTPAPRLLTPQQALEKFNGDKTAAANYLGI
FT                   SRTTFWRRLKS"
     atggcacatc caccacggct taatgacgac aaaccggtta tctggacggt atctgtaacg        60
     cgcctgttcg agctgtttcg cgatatcagc ctcgagtttg atcacctggc gaacattacc       120
     cctatccagc ttggctttga aaaagcggtg acctacatcc acaagaaact ggcaaacgaa       180
     cgctgtgacg ccatcatcgc cgctggatct aacggcgcgt acctgaaaag ccgcctgtca       240
     gtgccagtta ttttgattaa accgagcggc tacgatgtgt tacaggcact ggcaaaagcc       300
     ggaaaactca cctcttctat cggcgttgtc acttatcagg aaactattcc ggcactggtg       360
     gcgtttcaaa aaacctttaa tttgcgcctc gatcaacgta gctacattac cgaagaagac       420
     gcacgcgggc agattaacga gctaaaagct aacggcaccg aagcggtggt cggcgcgggg       480
     ctgattaccg atctggcaga agaagccgga atgaccggaa tttttatcta ttccgccgcc       540
     accgtgcgcc aggcgttcag cgatgcgctg gatatgacgc gcatgtcgtt acgccataac       600
     actcacgatg ccacccgcaa cgccctgaga actcgttacg tgctgggcga tatgctcggt       660
     caatcaccac agatggaaca agtacggcag actattttgc tgtatgcccg ctccagtgca       720
     gcggtgttga ttgaggggga aacggggacg ggcaaagagc tggcggccca ggcgattcat       780
     cgggaatatt ttgcccgcca cgatgcgcga cagggcaaaa agtcgcatcc gtttgttgca       840
     gtcaactgcg gggcgattgc cgaatcgctg ctggaagcag aactgtttgg ctatgaggaa       900
     ggggcgttta ccggctcgcg acgcggcggt cgcgccgggc tgtttgaaat cgcccacgga       960
     ggtacgctgt ttctcgatga gattggcgaa atgccgctgc cgttgcagac ccggctgctg      1020
     cgggtgctgg aagaaaaaga ggtcacccgc gtcggcgggc atcagcctgt tccggtggat      1080
     gtgcgggtca ttagcgccac tcactgcaat ctggaagaag atatgcggca agggcagttt      1140
     cgccgtgacc tgttttatcg gctgagtatt ttgcgtctgc aattgccacc actgcgcgag      1200
     cgggtggcgg atattctgcc actggcggaa agctttttga aagtgtctct ggcggcgctc      1260
     tccaccccgt tttctgccgc attacgccag ggattacagg caagcgaaac cgtgctggtg      1320
     cactacgact ggccgggcaa tattcgtgaa ctgcgcaata tgatggagcg actggcgcta      1380
     tttttaagtg tggaaccgac gccggattta acgccgcaat ttttgcagct gctactgccg      1440
     gaactggcgc gcgagtcggc gaaaactccc gctccacgct tactgacacc acaacaggca      1500
     ctggagaaat ttaatggcga taaaacagca gcggcgaatt atttaggcat cagccggacg      1560
     acgttctggc ggcggctgaa aagctga                                          1587
//

If you have problems or comments...

PBIL Back to PBIL home page