(data stored in ACNUC7421 zone)

EMBL: CP001509.PSIF

CP001509.PSIF        Location/Qualifiers
FT   CDS_pept        367906..368226
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="psiF"
FT                   /locus_tag="ECD_00331"
FT                   /product="PsiF family protein"
FT                   /note="similar to b0384"
FT                   /db_xref="EnsemblGenomes-Gn:ECD_00331"
FT                   /db_xref="EnsemblGenomes-Tr:ACT42230"
FT                   /protein_id="ACT42230.1"
FT                   /translation="MKITLLVTLLFGLVFLTTVGAAERTLTPQQQHMTSCNQQATAQAL
FT                   KGDARKTYMSDCLKNSKSAPGEKSLTPQQQKMRECNNQATQQSLKGDDRNKFMSACLKK
FT                   AA"
     atgaaaataa cattactggt taccttgctt ttcggactgg tttttttaac caccgtcggc        60
     gctgccgaga gaaccttaac cccgcaacaa cagcatatga cctcctgtaa tcagcaggcg       120
     acggcgcagg cgttgaaagg ggatgctcgt aagacctaca tgagtgattg cctgaagaac       180
     agcaagtctg cgcctggtga aaaaagtttg acgccacagc agcaaaagat gcgcgaatgt       240
     aataatcaag caacgcaaca atctctgaaa ggtgatgatc gtaataagtt tatgagtgcc       300
     tgcctcaaga aagccgcctg a                                                 321
//

If you have problems or comments...

PBIL Back to PBIL home page