(data stored in ACNUC7421 zone)

EMBL: CP001509.PYRH

CP001509.PYRH        Location/Qualifiers
FT   CDS_pept        194698..195423
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pyrH"
FT                   /locus_tag="ECD_00169"
FT                   /product="uridylate kinase"
FT                   /EC_number="2.7.4.-"
FT                   /note="similar to b0171"
FT                   /db_xref="EnsemblGenomes-Gn:ECD_00169"
FT                   /db_xref="EnsemblGenomes-Tr:ACT42070"
FT                   /protein_id="ACT42070.1"
FT                   /translation="MATNAKPVYKRILLKLSGEALQGTEGFGIDASILDRMAQEIKELV
FT                   ELGIQVGVVIGGGNLFRGAGLAKAGMNRVVGDHMGMLATVMNGLAMRDALHRAYVNARL
FT                   MSAIPLNGVCDSYSWAEAISLLRNNRVVILSAGTGNPFFTTDSAACLRGIEIEADVVLK
FT                   ATKVDGVFTADPAKDPTATMYEQLTYSEVLEKELKVMDLAAFTLARDHKLPIRVFNMNK
FT                   PGALRRVVMGEKEGTLITE"
     atggctacca atgcaaaacc cgtctataaa cgcattctgc ttaagttgag tggcgaagct        60
     ctgcagggca ctgaaggctt cggtattgat gcaagcatac tggatcgtat ggctcaggaa       120
     atcaaagaac tggttgaact gggtattcag gttggtgtgg tgattggtgg gggtaacctg       180
     ttccgtggcg ctggtctggc gaaagcgggt atgaaccgcg ttgtgggcga ccacatgggg       240
     atgctggcga ccgtaatgaa cggcctggca atgcgtgatg cactgcaccg cgcctatgtg       300
     aacgctcgtc tgatgtccgc tattccattg aatggcgtgt gcgacagcta cagctgggca       360
     gaagctatca gcctgttgcg caacaaccgt gtggtgatcc tctccgccgg tacaggtaac       420
     ccgttcttta ccaccgactc agcagcttgc ctgcgtggta tcgaaattga agccgatgtg       480
     gtgctgaaag caaccaaagt tgacggcgtg tttaccgctg atccggcgaa agatccaacc       540
     gcaaccatgt acgagcaact gacttacagc gaagtgctgg aaaaagagct gaaagtcatg       600
     gacctggcgg ccttcacgct ggctcgtgac cataaattac cgattcgtgt tttcaatatg       660
     aacaaaccgg gtgcgctgcg ccgtgtggta atgggtgaaa aagaagggac tttaatcacg       720
     gaataa                                                                  726
//

If you have problems or comments...

PBIL Back to PBIL home page