(data stored in ACNUC7421 zone)

EMBL: CP001509.QMCA

CP001509.QMCA        Location/Qualifiers
FT   CDS_pept        complement(484003..484920)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="qmcA"
FT                   /locus_tag="ECD_00440"
FT                   /product="PHB domain membrane-anchored putative protease"
FT                   /note="similar to b0489"
FT                   /db_xref="EnsemblGenomes-Gn:ECD_00440"
FT                   /db_xref="EnsemblGenomes-Tr:ACT42339"
FT                   /protein_id="ACT42339.1"
FT                   /translation="MLIFIPILIFVALVIVGAGVKIVPQGYQWTVERFGRYTKTLQPGL
FT                   SLVVPFMDRIGRKINMMEQVLDIPSQEVISKDNANVTIDAVCFIQVIDAPRAAYEVSNL
FT                   ELAIINLTMTNIRTVLGSMELDEMLSQRDSINSRLLRIVDEATNPWGIKVTRIEIRDVR
FT                   PPAELISSMNAQMKAERTKRAYILEAEGIRQAEILKAEGEKQSQILKAEGERQSAFLQA
FT                   EARERSAEAEARATKMVSEAIASGDIQAVNYFVAQKYTEALQQIGSSSNSKVVMMPLEA
FT                   SSLMGSIAGIAELVKDSANKRTQP"
     atgcttatct ttatcccgat tctcattttt gtcgcgctgg tcattgtcgg cgcgggcgtc        60
     aaaatcgtgc cgcagggcta tcaatggacg gtagaacgtt ttggtcgcta taccaaaacg       120
     ttacagccgg ggctcagtct ggtggtgccg tttatggatc gcattggtcg caagatcaat       180
     atgatggagc aagtgctcga tatcccttcc caggaagtta tctcgaaaga taacgccaac       240
     gttaccatcg acgccgtgtg ctttattcag gtgattgacg cgccacgcgc tgcctatgaa       300
     gtcagcaatc tggagctggc gatcatcaac ctgaccatga ctaacatccg taccgtgttg       360
     ggttcaatgg aacttgacga aatgctctct cagcgcgaca gcatcaactc acgcctgctg       420
     cgtattgtcg atgaagccac caacccgtgg gggattaaag tcacccgtat tgaaattcgc       480
     gacgtgcgcc caccggcaga gcttatctct tcaatgaacg cgcagatgaa agcggaacgt       540
     accaaacgcg cttacattct tgaagcggaa gggatccgtc aggcggaaat cctcaaagcc       600
     gaaggtgaaa aacagtcgca aatcctgaaa gcagaaggcg aacgtcagtc ggcgttttta       660
     caggctgaag cgcgtgaacg ttccgccgaa gcagaagccc gcgccaccaa aatggtgtct       720
     gaagctatcg cctccggtga tattcaggcg gtgaactact tcgtagcgca gaaatacacc       780
     gaagcgttac agcagatcgg ttcctccagt aacagcaaag tggtgatgat gccattagag       840
     gccagcagcc tgatggggtc gattgccggg attgccgagc tggtgaaaga cagcgccaac       900
     aagcggactc agccatga                                                     918
//

If you have problems or comments...

PBIL Back to PBIL home page