(data stored in ACNUC7421 zone)

EMBL: CP001509.R

CP001509.R           Location/Qualifiers
FT   CDS_pept        765466..765942
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="R"
FT                   /locus_tag="ECD_10030"
FT                   /product="cell lysis protein"
FT                   /note="similar to lambdap75"
FT                   /db_xref="EnsemblGenomes-Gn:ECD_10030"
FT                   /db_xref="EnsemblGenomes-Tr:ACT42612"
FT                   /protein_id="ACT42612.1"
FT                   /translation="MVEINNQRKAFLDMLAWSEGTDNGRQKTRNHGYDVIVGGELFTDY
FT                   SDHPRKLVTLNPKLKSTGAGRYQLLSRWWDAYRKQLGLKDFSPKSQDAVALQQIKERGA
FT                   LPMIDRGDIRQAIDRCSNIWASLPGAGYGQFEHKADSLIAKFKEAGGTVREIDV"
     atggtagaaa tcaataatca acgtaaggcg ttcctcgata tgctggcgtg gtcggaggga        60
     actgataacg gacgtcagaa aaccagaaat catggttatg acgtcattgt aggcggagag       120
     ctattcactg attactccga tcaccctcgc aaacttgtca cgctaaaccc aaaactcaaa       180
     tcaacaggcg ccggacgcta ccagcttctt tcccgttggt gggatgccta ccgcaagcag       240
     cttggcctga aagacttctc tccgaaaagt caggacgctg tggcattgca gcagattaag       300
     gagcgtggcg ctttacctat gattgatcgt ggtgatatcc gtcaggcaat cgaccgttgc       360
     agcaatatct gggcttcact gccgggcgct ggttatggtc agttcgagca taaggctgac       420
     agcctgattg caaaattcaa agaagcgggc ggaacggtca gagagattga tgtatga          477
//

If you have problems or comments...

PBIL Back to PBIL home page