(data stored in ACNUC7421 zone)

EMBL: CP001509.RAL

CP001509.RAL         Location/Qualifiers
FT   CDS_pept        complement(759208..759408)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ral"
FT                   /locus_tag="ECD_10018"
FT                   /product="restriction alleviation protein"
FT                   /note="similar to lambdap46"
FT                   /db_xref="EnsemblGenomes-Gn:ECD_10018"
FT                   /db_xref="EnsemblGenomes-Tr:ACT42600"
FT                   /protein_id="ACT42600.1"
FT                   /translation="MTTTIDKNQWCGQFKRCNGCKLQSECMVKPEEMFPVMEDGKYVDK
FT                   WAIRTTAMIARELGKQNNKAA"
     atgactacga ctattgataa aaatcaatgg tgtggacaat tcaagcgatg caatggatgc        60
     aagctgcaat cggaatgcat ggttaagcct gaagaaatgt ttcctgtaat ggaagatggg       120
     aaatatgtcg ataaatgggc aatacgaacg acggcaatga ttgccagaga acttggtaaa       180
     cagaacaaca aagctgcctg a                                                 201
//

If you have problems or comments...

PBIL Back to PBIL home page