(data stored in ACNUC7421 zone)

EMBL: CP001509.RCLA

CP001509.RCLA        Location/Qualifiers
FT   CDS_pept        complement(288304..289629)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rclA"
FT                   /locus_tag="ECD_00260"
FT                   /product="reactive chlorine stress species (RCS) resistance
FT                   protein; pyridine nucleotide-dependent disulfide
FT                   oxidoreductase family"
FT                   /note="similar to b0304"
FT                   /db_xref="EnsemblGenomes-Gn:ECD_00260"
FT                   /db_xref="EnsemblGenomes-Tr:ACT42159"
FT                   /protein_id="ACT42159.1"
FT                   /translation="MNKYQAVIIGFGKAGKTLAVTLAKAGWRVALIEQSNAMYGGTCIN
FT                   IGCIPTKTLVHDAQQHTDFVRAIQRKNEVVNFLRNKNFHNLADMPNIDVIDGQAEFINN
FT                   HSLRVHRPEGNLEIHGEKIFINTGAQTVVPPIPGITTTPGVYDSTGLLNLKELPGHLGI
FT                   LGGGYIGVEFASMFANFGSKVTILEAASLFLPREDRDIADNIATILRDQGVDIILNAHV
FT                   ERISHHENQVQVHSEHAQLAVDALLIASGRQPATASLHPENAGIAVNERGATVVDKRLH
FT                   TTADNIWAMGDVTGGLQFTYISLDDYRIVRDELLGEGKRSTDDRKNVPYSVFMTPPLSR
FT                   VGMTEEQARESGADIQVVTLPVAAIPRARVMNDTRGVLKAIVDNKTQRMLGASLLCVDS
FT                   HEMINIVKMVMDAGLPYSILRDQIFTHPSMSESLNDLFSLVK"
     atgaataaat atcaggcagt gattattggt tttggcaagg ctggaaaaac attagccgtc        60
     acgctggcaa aagcaggttg gcgagtggct ctcatcgaac aatcaaatgc aatgtatggc       120
     gggacctgta ttaatatcgg ctgcatccca accaaaacat tggttcatga cgcacagcag       180
     cacacagatt ttgtccgtgc catacagcgt aaaaatgaag tggttaattt tttacgtaat       240
     aagaattttc ataatcttgc ggatatgccc aatatcgacg tgatcgacgg ccaggcggag       300
     tttatcaata atcatagcct gcgtgttcat cggcctgagg gaaatctgga aattcatggc       360
     gagaaaattt ttattaatac cggtgcacaa accgtggttc cgccaattcc tggaattacc       420
     accacgccag gagtatatga cagcaccgga ttacttaatc taaaagaatt gcctgggcat       480
     ttaggtattt tgggcggcgg atatattggc gttgagttcg cctctatgtt cgctaatttt       540
     ggcagcaagg taaccatttt agaagcagct tcgctgtttt tgcctcggga agatcgggat       600
     attgctgata atatcgcgac gattttacgc gatcagggcg tcgatattat cctcaatgcc       660
     catgtggagc gaatcagtca ccatgaaaat caagtgcaag tgcatagcga gcacgcccaa       720
     ctggcggtgg atgcactgtt aatagcttcc ggtcgtcaac cggctaccgc ttcgttacat       780
     ccagaaaatg ccggtatcgc agtaaacgag cgcggggcaa ctgtcgttga caagcgatta       840
     cataccaccg cagacaatat ttgggcgatg ggagatgtta ccggcgggct gcaatttact       900
     tacatatcac tggatgatta ccgcattgta cgtgatgagt tactgggtga aggcaaacgt       960
     agtactgatg atcggaaaaa tgtgccttat tccgtattta tgacaccgcc cctgtccagg      1020
     gttggtatga cagaagaaca agccagagag agtggtgctg atattcaggt ggtgacattg      1080
     cctgtagctg caattccgcg tgccagagtg atgaatgata ctcgtggggt attaaaagcg      1140
     attgttgata ataaaaccca acgtatgtta ggggcatcac tgctgtgtgt tgactcccac      1200
     gagatgatca atatagtgaa aatggtgatg gatgccgggc tgccttatag catattacgc      1260
     gatcagatat ttactcatcc gtcgatgagc gaatcactca atgatctatt ttcattagtc      1320
     aaataa                                                                 1326
//

If you have problems or comments...

PBIL Back to PBIL home page