(data stored in ACNUC7421 zone)

EMBL: CP001509.RCLB

CP001509.RCLB        Location/Qualifiers
FT   CDS_pept        complement(287959..288195)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rclB"
FT                   /locus_tag="ECD_00259"
FT                   /product="reactive chlorine species (RCS) stress resistance
FT                   periplasmic protein"
FT                   /note="similar to b0303"
FT                   /db_xref="EnsemblGenomes-Gn:ECD_00259"
FT                   /db_xref="EnsemblGenomes-Tr:ACT42158"
FT                   /protein_id="ACT42158.1"
FT                   /translation="MFKKSVLFATLLSGVMAFSTNADDKIILKHISVSSVSASPTVLED
FT                   AIADIARKYNASSWKVTSMRIDNNSTATAVLYK"
     atgtttaaaa aatccgtttt atttgcaacg ctattatctg gcgttatggc attttccacc        60
     aatgcagatg ataaaataat tctgaaacat atcagcgtct cgtcagtatc agcatcaccg       120
     acagttctgg aggatgccat tgctgatata gccagaaaat ataatgcttc atcctggaaa       180
     gtcacatcga tgcgaattga taataattca accgcaacag cagtattgta taaataa          237
//

If you have problems or comments...

PBIL Back to PBIL home page