(data stored in ACNUC7421 zone)

EMBL: CP001509.RCLC

CP001509.RCLC        Location/Qualifiers
FT   CDS_pept        complement(287354..287947)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rclC"
FT                   /locus_tag="ECD_00258"
FT                   /product="reactive chlorine species (RCS) stress resistance
FT                   inner membrane protein"
FT                   /note="similar to b0301"
FT                   /db_xref="EnsemblGenomes-Gn:ECD_00258"
FT                   /db_xref="EnsemblGenomes-Tr:ACT42157"
FT                   /protein_id="ACT42157.1"
FT                   /translation="MEKYLHLLSRGDKIGLTLIRLSIAIVFMWIGLLKFVPYEADSITP
FT                   FVANSPLMSFFYEHPEDYKQYLTHEGEYKPEARAWQTANNTYGFSNGLGVVEVIIALLV
FT                   LANPVNRWLGLLGGLMAFTTPLVTLSFLITTPEAWVPALGDAHHGFPYLSGAGRLVLKD
FT                   TLMLAGAVMIMADSAREILKQRSNESSSTLKTEY"
     atggaaaaat acctgcacct gttaagtcgg ggagataaaa ttggcctgac attgattcgt        60
     ctgagtattg caattgtttt tatgtggatt gggttattaa agtttgtccc ttacgaggca       120
     gacagcatta caccattcgt cgcaaacagt ccactaatgt cgttctttta tgaacacccg       180
     gaagactata aacagtatct gactcacgaa ggcgaataca aaccagaagc aagggcatgg       240
     caaacggcca ataataccta tggtttttcc aacggtcttg gcgtcgtgga ggtgattatt       300
     gctctgctgg ttttggctaa tcctgtcaat cgctggttag gtttattggg aggactgatg       360
     gcatttacca cgccgctggt aacactctca tttttaatca ccaccccgga ggcatgggta       420
     cccgcattgg gtgacgctca tcatggtttc ccttatttat ccggtgctgg tcgcctggta       480
     ttgaaagata ctctgatgct ggcaggtgct gtcatgataa tggcagattc ggcgcgggaa       540
     attcttaaac aacgcagtaa tgaatccagt tcaacgttaa aaactgaata ttga             594
//

If you have problems or comments...

PBIL Back to PBIL home page