(data stored in ACNUC7421 zone)

EMBL: CP001509.RCSF

CP001509.RCSF        Location/Qualifiers
FT   CDS_pept        complement(222432..222836)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rcsF"
FT                   /locus_tag="ECD_00195"
FT                   /product="putative outer membrane protein"
FT                   /note="similar to b0196"
FT                   /db_xref="EnsemblGenomes-Gn:ECD_00195"
FT                   /db_xref="EnsemblGenomes-Tr:ACT42096"
FT                   /protein_id="ACT42096.1"
FT                   /translation="MRALPICLVALMLSGCSMLSRSPVEPVQSTAPQPKAEPAKPKAPR
FT                   ATPVRIYTNAEELVGKPFRDLGEVSGDSCQASNQDSPPSIPTARKRMQINASKMKANAV
FT                   LLHSCEVTSGTPGCYRQAVCIGSALNITAK"
     atgcgtgctt taccgatctg tttagtagca ctcatgctaa gcggctgttc catgttaagc        60
     agatcccctg tcgaacccgt tcaaagcact gcaccccagc cgaaagcgga gcctgcaaaa       120
     ccgaaagcgc cgcgcgccac gccggtccga atttatacca atgcagaaga attagtcggc       180
     aaaccgttcc gcgatctcgg tgaagtcagt ggcgactctt gccaggcctc taatcaggac       240
     tctccgccga gcattccaac cgcacgtaag cggatgcaaa tcaacgcctc gaaaatgaaa       300
     gccaatgcgg tattactgca tagctgcgaa gttaccagcg gtacgccagg ctgctatcgt       360
     caggctgtat gtatcggctc tgcgcttaac attacggcga aatga                       405
//

If you have problems or comments...

PBIL Back to PBIL home page