(data stored in ACNUC7421 zone)

EMBL: CP001509.RECR

CP001509.RECR        Location/Qualifiers
FT   CDS_pept        463451..464056
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="recR"
FT                   /locus_tag="ECD_00423"
FT                   /product="gap repair protein"
FT                   /note="similar to b0472"
FT                   /db_xref="EnsemblGenomes-Gn:ECD_00423"
FT                   /db_xref="EnsemblGenomes-Tr:ACT42322"
FT                   /protein_id="ACT42322.1"
FT                   /translation="MQTSPLLTQLMEALRCLPGVGPKSAQRMAFTLLQRDRSGGMRLAQ
FT                   ALTRAMSEIGHCADCRTFTEQEVCNICSNPRRQENGQICVVESPADIYAIEQTGQFSGR
FT                   YFVLMGHLSPLDGIGPDDIGLDRLEQRLAEEKITEVILATNPTVEGEATANYIAELCAQ
FT                   YDVEASRIAHGVPVGGELEMVDGTTLSHSLAGRHKIRF"
     atgcaaacca gcccgctgtt aacacagctt atggaagcac tgcgctgtct gccgggcgtt        60
     ggcccgaagt cggcgcagcg tatggcgttc acgctgcttc agcgcgatcg tagcggcggg       120
     atgcgtctgg cgcaggcgct cacccgggcg atgtcggaaa tcggccactg cgccgattgc       180
     cgcactttca ccgaacagga agtctgtaac atctgttcga atccgcgtcg tcaggaaaac       240
     ggtcaaatct gcgtggtgga gagtccggcg gacatctacg ccattgagca gacggggcag       300
     ttttcaggtc gttattttgt gttgatgggg catctgtcac cgctggacgg catcggtccg       360
     gatgatatcg ggcttgatcg tctggaacag cgtctggcag aggaaaaaat cactgaagtg       420
     atcctcgcca ccaatcccac ggttgaaggt gaagctaccg ctaactacat tgccgagctt       480
     tgcgcgcaat atgacgtgga agccagccga atcgctcatg gcgtaccggt tggcggcgaa       540
     ctggaaatgg tcgatggcac cacgctgtca cactcccttg ccgggcgtca taagattcgt       600
     ttttaa                                                                  606
//

If you have problems or comments...

PBIL Back to PBIL home page