(data stored in ACNUC7421 zone)

EMBL: CP001509.REN

CP001509.REN         Location/Qualifiers
FT   CDS_pept        763059..763862
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ren"
FT                   /locus_tag="ECD_10026"
FT                   /product="ren exclusion protein"
FT                   /note="similar to lambdap62"
FT                   /db_xref="EnsemblGenomes-Gn:ECD_10026"
FT                   /db_xref="EnsemblGenomes-Tr:ACT42608"
FT                   /protein_id="ACT42608.1"
FT                   /translation="MTGKEAIIHYLGTHNSFCAPDVAALTGATVTSINQAAAKMARAGL
FT                   LVIEGKVWRTVYYRFATREEREGKMSTNLMNKLDTIGFDNKKDLLISVGDLVDRGAENV
FT                   ECLELITFPWFRAVRGNHEQMMIDGLSERGNVNHWLLNGGGWFFNLDYDKEILAKALAH
FT                   KADELPLIIELVSKDKKYVICHADYPFDEYEFGKPVDHQQVIWNRERISNSQNGIVKEI
FT                   KGADTFIFGHTPAVKPLKFANQMYIDTGAVFCGNLTLIQVQGEGA"
     atgacgggca aagaggcaat tattcattac ctggggacgc ataatagctt ctgtgcgccg        60
     gacgttgccg cgctaacagg cgcaacagta accagcataa atcaggccgc ggctaaaatg       120
     gcacgggcag gtcttctggt tatcgaaggt aaggtctggc gaacggtgta ttaccggttt       180
     gctaccaggg aagaacggga aggaaagatg agcacgaacc tgatgaacaa actggatacg       240
     attggattcg acaacaaaaa agacctgctt atctcggtgg gcgatttggt tgatcgtggt       300
     gcagagaacg ttgaatgcct ggaattaatc acattcccct ggttcagagc tgtacgtgga       360
     aaccatgagc aaatgatgat tgatggctta tcagagcgtg gaaacgttaa tcactggctg       420
     cttaatggcg gtggctggtt ctttaatctc gattacgaca aagaaattct ggctaaagct       480
     cttgcccata aagcagatga acttccgtta atcatcgaac tggtgagcaa agataaaaaa       540
     tatgttatct gccacgccga ttatcccttt gacgaatacg agtttggaaa gccagttgat       600
     catcagcagg taatctggaa ccgcgaacga atcagcaact cacaaaacgg gatcgtgaaa       660
     gaaatcaaag gcgcggacac gttcatcttt ggtcatacgc cagcagtgaa accactcaag       720
     tttgccaacc aaatgtatat cgataccggc gcagtgttct gcggaaacct aacattgatt       780
     caggtacagg gagaaggcgc atga                                              804
//

If you have problems or comments...

PBIL Back to PBIL home page