(data stored in ACNUC7421 zone)

EMBL: CP001509.RHSC

CP001509.RHSC        Location/Qualifiers
FT   CDS_pept        689635..691299
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rhsC"
FT                   /locus_tag="ECD_00658"
FT                   /product="Rhs protein with putative toxin domain; putative
FT                   neighboring cell growth inhibitor"
FT                   /note="similar to b0700"
FT                   /db_xref="EnsemblGenomes-Gn:ECD_00658"
FT                   /db_xref="EnsemblGenomes-Tr:ACT42534"
FT                   /protein_id="ACT42534.1"
FT                   /translation="MKPTSPCPPRCRSSSPAPTAVTGQKRPRRWGASAPAGKCLRITGV
FT                   HTTAANLDIRIPYATDPAGNRLPDPELHPDSTLSMWPDNRIARDAHYLYRYDRHGRLTE
FT                   KTDLIPEGVIRTDDERTHQYHYDSQHRLVHYTRTQYAEPLVESRYLYDPLGRRVAKRVW
FT                   RRERDLTGWMSLSRKPEVTWYGWDGDRLTTIQNDRTRIQTIYQPGSFTPLIRVETATGE
FT                   LAKTQRRSLADTLQQSGGEDGGSVVFPPVLVQMLDRLESEILADRVSEESRRWLASCGL
FT                   TVAQMQNQMDPVYTPARKIHLYHCDHRGLPLALISKEGATEWCAEYDEWGNLLNEENPH
FT                   QLQQLIRLPGQQYDEESGLYYNRHRYYDPLQGRYITQDPIGLKGGWNFYQYPLNPISNI
FT                   DPLGLETLKCIKPLHSMGGTGERSGPDIWGNPFYHQYLCVPDGKGDYTCGGQDQRGESK
FT                   GDGLWGPGKASNDTKEAAGRCDLVETDNSCVENCLKGKFKEVRPRYSVLPDIFTPINLG
FT                   LFKNCQDWSNDSLETCKMKCSGNNIGRFIRFVFTGVM"
     gtgaaaccga catcgccctg cccgccccgc tgccgttcat cctctcccgc acctacagca        60
     gttaccggac aaaaacgccc gcgccggtgg ggagcctcgg ccccggctgg aaaatgcctg       120
     cggataaccg gcgttcacac caccgcagcg aatctggata tccgcatccc gtatgccaca       180
     gacccggcag gtaaccgcct gcccgacccg gagctgcacc cggacagcac cctcagcatg       240
     tggccggata accgtatcgc ccgtgacgcg cactatcttt accggtatga ccgtcacggc       300
     aggctgacag agaaaaccga cctcatcccg gaaggggtta tccgcacgga tgatgagcgc       360
     acccaccagt accattacga cagtcagcac cggctggtgc actacacgcg gacacaatat       420
     gcagagccgc tggtcgaaag tcgctatctt tacgacccgc tgggccgcag ggtggcaaaa       480
     cgggtatggc gacgtgaacg ggacctgacg ggctggatgt cgctgtcacg gaaaccggaa       540
     gtgacctggt acggctggga cggcgaccgg ctgaccacga tacagaacga cagaacccgc       600
     atccagacga tttatcagcc ggggagcttc acgccactca tcagagttga aactgccacc       660
     ggtgagctgg cgaaaacgca gcgccgcagc ctggcggata cccttcagca gtccggcggc       720
     gaagacggtg gcagtgtggt gttcccgccg gtgctggtgc agatgctcga ccggctggaa       780
     agtgaaatcc tggctgaccg ggtgagtgag gaaagccgcc gctggctggc atcgtgcggc       840
     ctgacggtgg cgcagatgca aaaccagatg gacccggtgt acacgccggc gcgaaaaatc       900
     cacctgtacc actgcgacca tcgcggcctg ccgctggccc ttatcagtaa ggaaggggca       960
     acagaatggt gcgcagaata cgatgagtgg ggcaacctgc tgaatgaaga gaacccgcat      1020
     cagctgcagc agcttatccg cctgccgggg cagcagtatg atgaggagtc cggcctgtat      1080
     tacaaccgcc accgctatta tgacccgctg caggggcgat atatcactca ggatccgatt      1140
     gggctgaaag ggggatggaa tttttatcag tatccgttga atccgatctc aaatatagat      1200
     ccattaggat tagaaacact aaaatgcatt aagccactgc attcaatggg cggaactggt      1260
     gaaagaagcg gtccagatat atgggggaat ccgttctatc atcaatatct ttgtgtccca      1320
     gatggtaaag gggactatac ttgtggtggc caagaccaac ggggagaatc aaaaggagat      1380
     ggtctatggg ggccaggtaa agcaagtaat gatacaaaag aagctgctgg ccgttgtgac      1440
     ctcgttgaaa ccgataatag ttgtgtggag aactgtttaa aagggaagtt taaagaggta      1500
     aggccgcgtt attctgtatt gcctgatata ttcacaccta taaatttagg gctatttaaa      1560
     aactgccaag actggtctaa tgattcttta gaaacatgta agatgaagtg ctccggaaat      1620
     aacattggac gttttattag atttgtattc accggagtga tgtaa                      1665
//

If you have problems or comments...

PBIL Back to PBIL home page