(data stored in ACNUC7421 zone)

EMBL: CP001509.RHSD

CP001509.RHSD        Location/Qualifiers
FT   CDS_pept        492407..496687
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rhsD"
FT                   /locus_tag="ECD_00448"
FT                   /product="Rhs protein with DUF4329 family putative toxin
FT                   domain; putative neighboring cell growth inhibitor"
FT                   /note="similar to b0497"
FT                   /db_xref="EnsemblGenomes-Gn:ECD_00448"
FT                   /db_xref="EnsemblGenomes-Tr:ACT42347"
FT                   /protein_id="ACT42347.1"
FT                   /translation="MSGKPAARQGDMTQYGGPIVQGSAGVRIGAPTGVACSVCPGGMTS
FT                   GNPVNPLLGAKVLPGETDLALPGPLPFILSRTYSSYRTRTPAPVGVFGPGWKAPSDIRL
FT                   QLRDDALVLNDNGGRSIHFEPLLPGEAVYSRSESMWLVRGGKAAQPDGHTLARLWGALP
FT                   PDIRLSPHLYLATNSAQGPWWILGWSERVPGAEDVLPAPLPPYRVLTGLADRFGRTLTY
FT                   RREAAGDLAGEITGVTDGAGREFRLVLTTQAQRAEEARTSSLSSSDSSRPLSASAFPDT
FT                   LPGTEYGPDRGIRLSAVWLMHDPAYPESLPAAPLVRYTYTEAGELLAVYDRSNTQVRAF
FT                   TYDAQHPGRMVAHRYAGRPEMRYRYDDTGRVVEQLNPAGLSYRYLYEQDRITVTDSLNR
FT                   REVLHTEGGAGLKRVVKKELADGSVTRSGYDAAGRLTAQTDAAGRRTEYGLNVVSGDIT
FT                   DITTPDGRETKFYYNDGNQLTAVVYPDGLESRREYDEPGRLVSETSRSGETVRYRYDDA
FT                   HSELPATTTDATGSTRQMTWSRYGQLLAFTDCSGYQTRYEYDRFGQMTAVHREEGISLY
FT                   RHYDNRGRLTSVKDAQGRETRYEYNAAGDLTAVITPDGNRSETQYDAWGKAVSTTQGGL
FT                   TRSMEYDAAGRVISLTNENGSHSVFSYDALDRLVQQGGFDGRTQRYHYDLTGKLTQSED
FT                   EGLVILWYYDASDRITHRTVNGEPAEQWQYDGHGWLTDISHLSEGHRVAVHYGYDDKGR
FT                   LTGECQTVENPETGELLWQHETKHAYNEQGLANRVTPDSLPPVEWLTYGSGYLAGMKLG
FT                   GTPLVEYTRDRLHRETVRSFGSMAGSNAAYELTSTYTPAGQLQSQHLNSLVYDRDYGWS
FT                   DNGDLVRISGPRQTREYGYSATGRLESVRTLAPDLDIRIPYATDPAGNRLPDPELHPDS
FT                   TLTVWPDNRIAEDAHYVYRHDEYGRLTEKTDRIPAGVIRTDDERTHHYHYDSQHRLVFY
FT                   TRIQHGEPLVESRYLYDPLGRRMAKRVWRRERDLTGWMSLSRKPEVTWYGWDGDRLTTV
FT                   QTDTTRIQTVYEPGSFTPLIRVETENGEREKAQRRSLAETLQQEGSENGHGVVFPAELV
FT                   RLLDRLEEEIRADRVSSESRAWLAQCGLTVEQLARQVEPEYTPARKAHLYHCDHRGLPL
FT                   ALISEDGNTAWSAEYDEWGNQLNEENPHHVYQPYRLPGQQHDEESGLYYNRHRYYDPLQ
FT                   GRYITQDPMGLKGGWNLYQYPLNPLQQIDPMGLLQTWDDARSGACTGGVCGVLSRIIGP
FT                   SKFDSTADAALDALKETQNRSLCNDMEYSGIVCKDTNGKYFASKAETDNLRKESYPLKR
FT                   KCPTGTDRVAAYHTHGADSHGDYVDEFFSSSDKNLVRSKDNNLEAFYLATPDGRFEALN
FT                   NKGEYIFIRNSVPGLSSVCIPYHD"
     atgagcggaa aaccagcggc gcgtcaggga gatatgactc agtatggcgg tcccattgtc        60
     cagggttcgg caggtgtaag aattggcgcg cccaccggcg tggcgtgctc ggtgtgtccg       120
     ggcgggatga cttcgggcaa cccggtaaat ccgctgctgg gggcgaaggt gctgcccggc       180
     gagacggacc ttgcgctgcc cggcccgctg ccgttcattc tctcccgcac ctacagcagc       240
     taccggacca ggacacccgc gccggtggga gtgtttggcc ccggctggaa agcgccttct       300
     gatatccgct tacagctacg cgatgatgca ctggtactca acgacaacgg cgggcggagc       360
     attcactttg agccgctgct gccgggggag gcggtgtaca gccgcagcga gtcaatgtgg       420
     ctggtgcgcg gtggtaaggc agcgcagccg gacggccaca cgctggcgcg gctgtggggg       480
     gcgctgccgc cggatatccg gttaagcccg catctttacc tggcgaccaa cagcgcacag       540
     gggccgtggt ggatactggg gtggtcagag cgggtaccgg gtgctgagga cgtactgcca       600
     gcgccgctgc cgccgtaccg ggtgcttacc gggctggcag accgtttcgg gcggacgctg       660
     acgtaccggc gtgaggccgc aggcgacctg gccggggaaa tcaccggcgt gacggacggt       720
     gccgggcggg agttccgtct ggtgctgacc acgcaggcgc agcgtgcgga agaggcccgc       780
     acctcttcgc tatcttcttc tgacagttcc cgccctctct cagcctcagc gttccccgac       840
     acactgcccg gtaccgaata cggccccgac aggggtatcc gcctttcggc ggtgtggctg       900
     atgcacgacc cggcataccc ggagagcctg cccgctgcgc cactggtgcg gtacacgtat       960
     acggaagccg gtgaactgct ggcggtatat gaccgcagca atacgcaggt gcgcgctttc      1020
     acgtatgacg cgcagcaccc gggccggatg gtggcgcacc gttacgcggg aaggccggag      1080
     atgcgctacc gctacgacga tacggggcgg gtggtggagc aactgaaccc ggcagggtta      1140
     agctaccgct atctttatga gcaggaccgc atcaccgtca ccgacagcct gaaccggcgt      1200
     gaggtgctgc atacagaagg cggggccggg ctgaaacggg tggtgaaaaa agaactggcg      1260
     gacggcagcg tcacgcgcag cgggtatgac gcggcaggaa ggctcacggc gcagacggac      1320
     gcggcgggac ggaggacaga gtacggtctg aatgtggtgt ccggcgatat cacggacatc      1380
     accacaccgg acgggcggga gacgaaattt tactataacg acgggaacca gctgacggcg      1440
     gtggtgtacc cggacgggct ggagagccgc cgggaatatg atgaaccggg caggctggta      1500
     tcggagacat cgcgcagcgg ggagacagta cgctaccgct acgatgacgc gcacagtgag      1560
     ttaccggcga cgacaacgga tgcgacgggc agcacccggc agatgacgtg gagccgctac      1620
     gggcagttgc tggcgttcac tgactgctcg ggctaccaga cccgctatga atacgaccgc      1680
     ttcggccaga tgacggcggt tcaccgcgag gaaggtatca gcctttaccg ccactatgac      1740
     aaccgtggcc ggttaacctc ggtgaaagac gcacagggcc gtgaaacgcg gtatgaatac      1800
     aacgccgcag gcgacctgac tgccgtcatt accccggacg gcaaccggag cgagacacag      1860
     tacgatgcgt ggggaaaggc ggtcagcacc acgcagggcg ggctgacgcg cagtatggag      1920
     tacgatgctg ccggacgtgt catcagcctg accaacgaga acggcagcca cagcgtcttc      1980
     agttacgatg cgctggaccg gctggtacag cagggcggct ttgacgggcg gacgcaacgt      2040
     tatcattatg acctgaccgg aaaactcacg cagagtgagg atgagggact tgtcatcctc      2100
     tggtactacg atgcgtcgga ccgcatcacg caccgcacgg tgaacggcga accggcagag      2160
     cagtggcagt atgatggcca cggctggctg acagacatca gccacctgag cgaaggccac      2220
     cgtgttgccg tccactatgg ctatgacgat aaaggccgcc tgaccggcga atgccagacg      2280
     gtggagaacc cggagacggg ggaactgctg tggcagcatg agacgaaaca cgcatacaac      2340
     gagcaggggc tggcaaaccg cgtcacgccg gacagcctgc cgccggtgga gtggctgacg      2400
     tatggcagcg gttacctggc gggcatgaag ctgggcggga cgccgctggt cgagtatacg      2460
     cgggacaggc tgcaccgtga gacggtgcgc agcttcggca gcatggcagg cagtaatgcc      2520
     gcatacgaac tgaccagcac atacaccccc gcaggccagt tacagagcca gcacctgaac      2580
     agcctggtat atgaccgtga ctacgggtgg agtgacaacg gcgacctggt gcgcatcagc      2640
     ggcccgcgac agacgcggga atacggctac agcgccacgg gcaggctgga gagtgtgcgc      2700
     accctcgcac cagacctgga catccgcatc ccgtatgcca cggacccggc gggcaaccgg      2760
     ctgccggacc cggagctgca cccggacagt acactcacag tgtggccgga taaccgcatc      2820
     gcggaggatg cgcactatgt ctaccgccac gatgaatacg gcaggctgac ggagaagacg      2880
     gaccgcatcc cggcgggtgt gatacggacg gacgacgagc ggacccacca ctaccactac      2940
     gacagccagc accgcctggt gttctacacg cggatacagc atggcgagcc actggtcgag      3000
     agccgctacc tctacgaccc gctgggacgg cgaatggcaa aacgggtctg gcggcgggag      3060
     cgtgacctga cggggtggat gtcgctgtcg cgtaaaccgg aggtgacgtg gtatggctgg      3120
     gacggagaca ggctgacgac ggtgcagact gacaccacac gtatccagac ggtatacgag      3180
     ccgggaagct tcacgccgct catccgggtc gagacagaga acggcgagcg ggaaaaagcg      3240
     cagcggcgca gcctggcaga gacgctccag caggaaggga gtgagaacgg ccacggcgtg      3300
     gtgttcccgg ctgaactggt gcggctgctg gacaggctgg aggaagaaat ccgggcagac      3360
     cgcgtgagca gtgaaagccg ggcgtggctt gcgcagtgcg ggctgacggt ggagcaactg      3420
     gccagacagg tggagccgga atacacaccg gcgcgaaaag ctcatcttta tcactgcgac      3480
     caccggggac tgccgctggc gcttatcagc gaagacggca atacggcgtg gagcgcggaa      3540
     tatgatgaat ggggcaacca gcttaatgag gagaacccgc atcatgtgta tcagccgtac      3600
     cgtctgccag ggcagcagca tgatgaggaa tcagggctgt actataaccg tcaccggtac      3660
     tacgatccgt tgcaggggcg gtatattact caggacccga tggggttgaa agggggatgg      3720
     aatttatatc agtatccttt aaatccacta caacaaattg accctatggg attattgcag      3780
     acttgggatg atgccagatc tggagcatgt acggggggag tttgtggtgt tctttcacgt      3840
     ataataggac caagtaaatt tgatagtact gcagatgctg cgttagatgc tttgaaagaa      3900
     acgcagaata gatctctatg taatgatatg gaatactctg gtattgtctg taaagatact      3960
     aatggaaaat attttgcatc taaggcagaa actgataatt taagaaagga gtcatatcct      4020
     ctgaaaagaa aatgtcccac aggtacagat agagttgctg cttatcatac tcacggtgca      4080
     gatagtcatg gcgattatgt tgatgaattt ttttcaagta gcgataaaaa tcttgtaaga      4140
     agtaaagata ataatcttga agcattttat ctcgcaacac ctgatggacg atttgaggcg      4200
     cttaataata aaggagaata tatttttatc agaaatagtg tcccgggatt gagttcagta      4260
     tgcataccgt atcatgatta a                                                4281
//

If you have problems or comments...

PBIL Back to PBIL home page