(data stored in ACNUC7421 zone)

EMBL: CP001509.RHSO

CP001509.RHSO        Location/Qualifiers
FT   CDS_pept        691743..693176
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rhsO"
FT                   /locus_tag="ECD_00660"
FT                   /product="conserved protein, rhs-like protein"
FT                   /note="similar to b0703"
FT                   /db_xref="EnsemblGenomes-Gn:ECD_00660"
FT                   /db_xref="EnsemblGenomes-Tr:ACT42536"
FT                   /protein_id="ACT42536.1"
FT                   /translation="MWPDNRIARDAHYLYRYDRHGRLTEKTDLIPEGVIRTDDERTHRY
FT                   HYDSQHRLVHYTRTQYAEPLVESRYLYDPLGRRVAKRVWRRERDLTGWMSLSRKPQVTW
FT                   YGWDGDRLTTIQNDRSRIQTIYQPGSFTPLIRVETATGELARTQRRSLADALQQSGGED
FT                   GGSVVFPPVLVQMLDRLESEILADRVSEESRRWLASCGLTVEQMQNQMDPVYTPARKIH
FT                   LYHCDHRGLPLALVSTEGATEWCAEYDEWGNLLNEENPHQLQQLIRLPGQQYDEESGLY
FT                   YNRHRYYDPLQGRYITQDPIGLKGGWNFYQYPLNPVQYIDSMGLASKYGHLNNGGYGAR
FT                   PNKPPTPDPSKLPDIAKQLRLPYPIDQASSAPNVFKTFFRALSPYDYTLYCRKWVKPNL
FT                   TCTPQDDSQYPGMDTKTASDYLPQTNWPTTQLPPGYTCAEPYLFPDINKPDGPATAGID
FT                   DLGEILAKMKQRTSRGIRK"
     atgtggccgg ataaccgtat cgcccgtgac gcgcactatc tttaccggta tgaccgtcac        60
     ggcaggctga cggagaaaac cgacctcatc ccggaagggg ttatccgcac ggatgatgag       120
     cgcacccacc ggtaccatta cgacagtcag caccggctgg tgcactacac gcggacacaa       180
     tatgcagagc cgctggtcga aagccgctat ctttacgacc cgctgggccg cagggtggca       240
     aaacgggtat ggcgacgtga acgggacctg acgggctgga tgtcgctgtc acggaaaccg       300
     caagtgacct ggtacggctg ggacggcgac cggctgacca cgatacagaa cgacaggagc       360
     cgcatccaga cgatttatca gccggggagc ttcacaccac tcatcagagt tgaaactgcc       420
     accggtgaac tggccagaac gcagcgccgc agcctggcgg atgcgcttca gcagtccggc       480
     ggcgaagacg gtggcagtgt ggtgttcccg ccggtgctgg tgcagatgct cgaccggctg       540
     gaaagtgaaa tcctggctga ccgggtgagt gaggaaagcc gccgctggct ggcatcgtgc       600
     ggcctgaccg tggagcagat gcaaaaccag atggacccgg tgtacacgcc ggcgcgaaaa       660
     atccacctgt accactgcga ccatcgcggc ctgccgctgg cgcttgtcag cacggaaggg       720
     gcaacagaat ggtgcgcaga atacgatgaa tggggcaacc tgctgaatga agagaacccg       780
     catcagctgc agcagcttat ccgcctgccg gggcagcagt atgatgagga gtccggcctg       840
     tattacaacc gccaccgcta ttatgacccg ctgcagggga ggtatatcac tcaggatccg       900
     attgggctga aggggggatg gaatttttat cagtatccgc tgaatccggt tcagtatata       960
     gattcaatgg gactggcatc aaaatatgga cacttaaata atggcggata tggagcgaga      1020
     cccaacaaac cgcctacgcc cgatccaagt aaattgccgg acatagcgaa acaattaaga      1080
     ctgccatatc ctattgacca ggccagtagt gcgcctaatg ttttcaaaac attcttcaga      1140
     gcattaagcc cttacgacta cacactgtat tgcaggaagt gggtaaaacc aaatctgact      1200
     tgtacgccac aggatgattc ccagtatcca gggatggata caaagacagc aagtgattac      1260
     ctgccacaga caaattggcc aacaactcaa ttaccaccag gatatacttg tgcagaaccc      1320
     tatttattcc cagacattaa taaacccgat gggccagcaa cagcagggat agatgatttg      1380
     ggtgaaattt tagctaagat gaaacagaga acatcgagag gaataagaaa atga            1434
//

If you have problems or comments...

PBIL Back to PBIL home page