(data stored in ACNUC7421 zone)

EMBL: CP001509.RIBF

CP001509.RIBF        Location/Qualifiers
FT   CDS_pept        25479..26420
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ribF"
FT                   /locus_tag="ECD_00029"
FT                   /product="bifunctional riboflavin kinase/FAD synthetase"
FT                   /EC_number="2.7.7.2"
FT                   /EC_number="2.7.1.26"
FT                   /note="similar to b0025"
FT                   /db_xref="EnsemblGenomes-Gn:ECD_00029"
FT                   /db_xref="EnsemblGenomes-Tr:ACT41931"
FT                   /protein_id="ACT41931.1"
FT                   /translation="MKLIRGIHNLSQAPQEGCVLTIGNFDGVHRGHRALLQGLQEEGRK
FT                   RNLPVMVMLFEPQPLELFATDKAPARLTRLREKLRYLAECGVDYVLCVRFDRRFAALTA
FT                   QNFISDLLVKLLRVKFLAVGDDFRFGAGREGDFLLLQKAGMEYGFDITSTQTFCEGGVR
FT                   ISSTAVRQALADDNLALAESLLGHPFAISGRVVHGDELGRTIGFPTANVPLRRQVSPVK
FT                   GVYAVEVLGLGEKPLPGVANIGTRPTVAGIRQQLEVHLLDVAMDLYGRHIQVVLRKKIR
FT                   NEQRFASLDELKAQIARDELTAREFFGLTKPA"
     atgaagctga tacgcggcat acataatctc agccaggccc cgcaagaagg gtgtgtgctg        60
     actattggta atttcgacgg cgtgcatcgc ggtcatcgcg cgctgttaca gggcttgcag       120
     gaagaagggc gcaagcgcaa cttaccggtg atggtgatgc tttttgaacc tcaaccactg       180
     gaactgtttg ctaccgataa agccccggca cggctgaccc ggctgcggga aaaactgcgt       240
     taccttgcag agtgtggcgt tgattacgtg ctgtgcgtgc gtttcgacag gcgtttcgcg       300
     gcgttaaccg cgcaaaattt catcagcgat cttctggtga agcttttgcg cgtaaaattt       360
     cttgccgtag gtgatgattt ccgctttggc gctggtcgtg aaggcgattt cttgttatta       420
     cagaaagctg gcatggaata cggcttcgat atcaccagta cgcaaacttt ttgcgaaggt       480
     ggcgtgcgta tcagcagcac cgctgtgcgt caggcgctgg cggatgacaa tctggctctg       540
     gcagaaagtt tactggggca cccgtttgcc atctccgggc gtgtagtcca cggtgatgaa       600
     ttagggcgca ctataggttt cccgacggcg aatgtaccgc tacgccgtca ggtttccccg       660
     gtgaaagggg tttatgcggt agaagtgctg ggcctcggtg aaaagccgtt acccggcgtg       720
     gcaaacatcg gaacacgccc aacggttgcc ggtattcgcc agcagctgga agtgcatttg       780
     ttagatgttg caatggacct ttacggtcgc catatacaag tagtgctgcg taaaaaaata       840
     cgcaatgagc agcgatttgc gtcgctggac gaactgaaag cgcagattgc gcgtgatgaa       900
     ttaaccgccc gcgaattttt tgggctaaca aaaccggctt aa                          942
//

If you have problems or comments...

PBIL Back to PBIL home page