(data stored in ACNUC7421 zone)

EMBL: CP001509.RLPA

CP001509.RLPA        Location/Qualifiers
FT   CDS_pept        complement(624465..625553)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rlpA"
FT                   /locus_tag="ECD_00602"
FT                   /product="septal ring protein, suppressor of prc, minor
FT                   lipoprotein"
FT                   /note="similar to b0633"
FT                   /db_xref="EnsemblGenomes-Gn:ECD_00602"
FT                   /db_xref="EnsemblGenomes-Tr:ACT42480"
FT                   /protein_id="ACT42480.1"
FT                   /translation="MRKQWLGICIAAGMLAACTSDDGQQQTVSVPQPAVCNGPIVEISG
FT                   ADPRFEPLNATANQDYQRDGKSYKIVQDPSRFSQAGLAAIYDAEPGSNLTASGEAFDPT
FT                   QLTAAHPTLPIPSYARITNLANGRMIVVRINDRGPYGNDRVISLSRAAADRLNTSNNTK
FT                   VRIDPIIVAQDGSLSGPGMACTTVAKQTYALPAPPDLSGGAGTSSVSGPQGDILPVSNS
FT                   TLKSEDPTGAPVTSSGFLGAPTTLAPGVLEGSEPTPAPQPVVTAPSTTPATSPAMVTPQ
FT                   AASQSASGNFMVQVGAVSDQARAQQYQQQLGQKFGVPGRVTQNGAVWRIQLGPFASKAE
FT                   ASTLQQRLQTEAQLQSFITTAQ"
     atgcgtaagc agtggctcgg gatctgcatc gcggcaggaa tgctcgcggc atgtacaagc        60
     gatgatggtc agcaacagac ggtaagtgta ccgcagcctg cggtatgtaa cggccccata       120
     gttgaaatta gcggggcgga cccgcgtttc gaaccactga acgcgacggc aaatcaggat       180
     taccagcgcg acggtaaaag ctacaaaatc gtgcaggatc cgtctcgatt tagccaggcg       240
     ggactggcgg caatctatga cgccgaacct ggcagtaacc tgacggcctc tggcgaagct       300
     ttcgatccga cacagttgac ggcggcccat ccaacgcttc cgatccccag ctacgccaga       360
     atcactaacc tggctaacgg gcgaatgatc gtggtgcgca ttaatgatcg cggtccttac       420
     ggcaacgacc gcgttatttc gctttctcgc gcagcagctg accgtcttaa cacatcaaac       480
     aacaccaaag ttcgtatcga tccgattatt gtcgcccagg atggttcgct ttctggtcct       540
     ggtatggctt gtaccactgt cgccaaacag acttacgccc tgcctgcacc tcccgattta       600
     agcggtggcg cgggaacaag ttcagtatct ggcccgcagg gtgacattct tccggtcagt       660
     aattcgacgc taaaaagcga agatccgacc ggcgcgccgg taaccagcag cggtttcctc       720
     ggcgcaccaa cgaccttagc gcctggtgta ctggaaggca gcgaaccgac acctgcacca       780
     cagcccgttg ttacagctcc gtcgacaacg cctgcaacct cgcctgcaat ggtgacaccg       840
     caagccgcct cgcaaagcgc cagcggcaac tttatggtgc aagtcggggc cgttagcgat       900
     caggctcgtg cgcaacagta ccaacagcaa ctgggacaga agttcggcgt ccccggtcgc       960
     gtaactcaaa atggcgcggt ctggcggatc cagcttggcc cattcgccag caaagccgaa      1020
     gccagtacct tgcagcaacg tttgcaaacc gaagcccaat tacagtcatt tattaccacc      1080
     gcgcagtag                                                              1089
//

If you have problems or comments...

PBIL Back to PBIL home page