(data stored in ACNUC7421 zone)

EMBL: CP001509.RSEP

CP001509.RSEP        Location/Qualifiers
FT   CDS_pept        199389..200741
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rseP"
FT                   /locus_tag="ECD_00174"
FT                   /product="inner membrane zinc RIP metalloprotease; RpoE
FT                   activator, by degrading RseA; cleaved signal peptide
FT                   endoprotease"
FT                   /note="similar to b0176"
FT                   /db_xref="EnsemblGenomes-Gn:ECD_00174"
FT                   /db_xref="EnsemblGenomes-Tr:ACT42075"
FT                   /protein_id="ACT42075.1"
FT                   /translation="MLSFLWDLASFIVALGVLITVHEFGHFWVARRCGVRVERFSIGFG
FT                   KALWRRTDKLGTEYVIALIPLGGYVKMLDERAEPVVPELRHHAFNNKSVGQRAAIIAAG
FT                   PVANFIFAIFAYWLVFIIGVPGVRPVVGEIAANSIAAEAQIAPGTELKAVDGIETPDWD
FT                   AVRLQLVDKIGDESTTITVAPFGSDQRRDVKLDLRHWAFEPDKEDPVSSLGIRPRGPQI
FT                   EPVLENVQPNSAASKAGLQAGDRIVKVDGQPLTQWVTFVMLVRDNPGKSLALEIERQGS
FT                   PLSLTLIPESKPGNGKAIGFVGIEPKVIPLPDEYKVVRQYGPFNAIVEATDKTWQLMKL
FT                   TVSMLGKLITGDVKLNNLSGPISIAKGAGMTAELGVVYYLPFLALISVNLGIINLFPLP
FT                   VLDGGHLLFLAIEKIKGGPVSERVQDFCYRIGSILLVLLMGLALFNDFSRL"
     atgctgagtt ttctctggga tttggcttcg ttcatcgttg cactgggtgt acttatcacc        60
     gtgcatgaat ttggtcattt ctgggttgcc cggcgttgtg gtgttcgcgt tgagcgtttc       120
     tcaatagggt ttggtaaggc gctctggcgg cgaactgata agctcggcac cgaatatgtt       180
     atcgccctga tcccgctggg cggttatgtc aaaatgctgg atgagcgcgc agaaccggtc       240
     gttccggaac tccgccacca tgccttcaat aataaatctg tcggccaacg agcggcgatt       300
     attgccgcag gtccggttgc aaacttcatt tttgctatct ttgcctactg gctggttttt       360
     attattggtg tgcctggcgt acgtccggtg gttggcgaaa tagcagccaa ttcgatagct       420
     gcggaagcac aaattgcacc aggtacggaa ctaaaagccg tagatggtat cgaaacgcct       480
     gattgggatg ccgtgcgttt gcagttggtc gataaaattg gcgatgaaag caccaccatt       540
     acagtagcgc catttggcag cgaccaacgg cgggatgtaa agctcgattt acgtcactgg       600
     gcgtttgagc ctgataaaga agatccggta tcttcgctgg ggattcgtcc tcgtgggccg       660
     caaattgaac ctgtactgga aaatgtgcaa ccaaactcgg cggcaagcaa ggcaggtttg       720
     caagcaggcg acaggatcgt taaagtcgat ggtcagccct taacgcagtg ggtgaccttt       780
     gtgatgcttg tccgggataa cccgggtaaa tccttagcgt tagaaatcga aaggcaggga       840
     agtcccttgt ctttgacatt aatcccggag agtaaaccgg gtaatggtaa agcgattggt       900
     tttgtcggta ttgagccgaa agtcattcct ttgccagatg agtataaagt tgtacgccag       960
     tatgggccgt tcaacgccat tgtcgaagcc acggacaaaa cgtggcagct gatgaagctg      1020
     acggtcagta tgctgggaaa attgatcacc ggtgatgtga aactgaacaa cctcagtggg      1080
     ccgatctcta tcgccaaggg ggctgggatg acagcggaac tcggggttgt ttattacctg      1140
     ccgtttcttg cgcttattag cgtgaactta gggataatta acctgtttcc gttgcccgta      1200
     cttgacgggg ggcatctgct gttccttgcg atcgaaaaga tcaagggcgg accggtatcc      1260
     gagcgggttc aagacttttg ttatcgcatt ggctcgattt tgctggtgct gttaatgggg      1320
     cttgcacttt tcaatgattt ctctcggtta tga                                   1353
//

If you have problems or comments...

PBIL Back to PBIL home page