(data stored in ACNUC7421 zone)

EMBL: CP001509.RZ

CP001509.RZ          Location/Qualifiers
FT   CDS_pept        765939..766400
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="Rz"
FT                   /locus_tag="ECD_10031"
FT                   /product="cell lysis protein"
FT                   /note="similar to lambdap76"
FT                   /db_xref="EnsemblGenomes-Gn:ECD_10031"
FT                   /db_xref="EnsemblGenomes-Tr:ACT42613"
FT                   /protein_id="ACT42613.1"
FT                   /translation="MSRVTAIISALVICIIVCLSWAVNHYRDNAITYKAQRDKNARELK
FT                   LANAAITDMQMRQRDVAALDAKYTKELADAKAENDALRDDVAAGRRRLHIKAVCQSVRE
FT                   ATTASGVDNAASPRLADTAERDYFTLRERLITMQKQLEGTQKYINEQCR"
     atgagcagag tcaccgcgat tatctccgct ctggttatct gcatcatcgt ctgcctgtca        60
     tgggctgtta atcattaccg tgataacgcc attacctaca aagcccagcg cgacaaaaat       120
     gccagagaac tgaagctggc gaacgcggca attactgaca tgcagatgcg tcagcgtgat       180
     gttgctgcgc tcgatgcaaa atacacgaag gagttagctg atgctaaagc tgaaaatgat       240
     gctctgcgtg atgatgttgc cgctggtcgt cgtcggttgc acatcaaagc agtctgtcag       300
     tcagtgcgtg aagccaccac cgcctccggc gtggataatg cagcctcccc ccgactggca       360
     gacaccgctg aacgggatta tttcaccctc agagagaggc tgatcactat gcaaaaacaa       420
     ctggaaggaa cccagaagta tattaatgag cagtgcagat ag                          462
//

If you have problems or comments...

PBIL Back to PBIL home page