(data stored in ACNUC7421 zone)

EMBL: CP001509.S

CP001509.S           Location/Qualifiers
FT   CDS_pept        765159..765482
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="S"
FT                   /locus_tag="ECD_10029"
FT                   /product="cell lysis protein"
FT                   /note="similar to lambdap74"
FT                   /db_xref="EnsemblGenomes-Gn:ECD_10029"
FT                   /db_xref="EnsemblGenomes-Tr:ACT42611"
FT                   /protein_id="ACT42611.1"
FT                   /translation="MKMPEKHDLLAAILAAKEQGIGAILAFAMAYLRGRYNGGAFTKTV
FT                   IDATMCAIIAWFIRDLLDFAGLSSNLAYITSVFIGYIGTDSIGSLIKRFAAKKAGVEDG
FT                   RNQ"
     atgaagatgc cagaaaaaca tgacctgttg gccgccattc tcgcggcaaa ggaacaaggc        60
     atcggggcaa tccttgcgtt tgcaatggcg taccttcgcg gcagatataa tggcggtgcg       120
     tttacaaaaa cagtaatcga cgcaacgatg tgcgccatta tcgcctggtt cattcgtgac       180
     cttctcgact tcgccggact aagtagcaat ctcgcttata taacgagcgt gtttatcggc       240
     tacatcggta ctgactcgat tggttcgctt atcaaacgct tcgctgctaa aaaagccgga       300
     gtagaagatg gtagaaatca ataa                                              324
//

If you have problems or comments...

PBIL Back to PBIL home page