(data stored in ACNUC7421 zone)

EMBL: CP001509.SBMA

CP001509.SBMA        Location/Qualifiers
FT   CDS_pept        361264..362484
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sbmA"
FT                   /locus_tag="ECD_00324"
FT                   /product="peptide antibiotic transporter"
FT                   /note="similar to b0377"
FT                   /db_xref="EnsemblGenomes-Gn:ECD_00324"
FT                   /db_xref="EnsemblGenomes-Tr:ACT42223"
FT                   /protein_id="ACT42223.1"
FT                   /translation="MFKSFFPKPGAFFLSAFVWALIAVIFWQAGGGDWVARITGASGQI
FT                   PISAARFWSLDFLIFYAYYIVCVGLFAFFWFIYSPHRWQYWSILGTALIIFVTWFLVEV
FT                   GVAVNAWYAPFYDLIQTALSSPHKVTIEQFYREVGVFLGIALIAVVISVLNNFFVSHYV
FT                   FRWRTAMNEYYMANWQQLRHIEGAAQRVQEDTMRFASTLENMGVSFINAIMTLIAFLPV
FT                   LVTLSAHVPELPIIGHIPYGLVIAAIVWSLMGTGLLAVVGIKLPGLEFKNQRVEAAYRK
FT                   ELVYGEDDATRATPPTVRELFSAVRKNYFRLYFHYMYFNIARILYLQVDNVFGLFLLFP
FT                   SIVAGTITLGLMTQITNVFGQVRGAFQYLINSWTTLVELMSIYKRLRSFEHELDGDKIQ
FT                   EVTHTLS"
     atgtttaagt cttttttccc aaagccggga gcgttttttc tctcggcctt tgtttgggca        60
     ttgattgccg ttatcttctg gcaagccggt gggggagact gggtggcgcg tatcactggc       120
     gcttccgggc agatcccgat tagcgccgcg cgtttctggt cgttggattt cctgattttt       180
     tacgcttact acattgtttg cgtaggactt tttgcatttt tctggtttat ctacagcccg       240
     caccgttggc aatactggtc aatactcggt actgcactga tcatcttcgt cacctggttt       300
     ttggtggaag tcggggtcgc cgtcaacgcc tggtatgcac cgttctatga tctgattcaa       360
     accgcgctaa gttcgccgca taaagtcact atcgaacaat tttaccgcga agtgggcgtc       420
     tttctgggga ttgcgctgat cgctgtggtg atcagtgtgc tgaacaactt ctttgtcagt       480
     cactacgtgt tccgctggcg tacggcgatg aacgaatatt acatggcgaa ctggcaacaa       540
     ctgcgtcata tcgaaggtgc cgcacagcgt gtgcaggaag acaccatgcg ttttgcttca       600
     acgctggaga atatgggcgt cagttttatc aacgccatca tgacgttgat cgccttcctg       660
     ccggtgctgg taacgctctc cgcgcatgtg ccggagctgc cgattatcgg gcacattccg       720
     tatggtctgg tgattgccgc aatcgtctgg tcgctgatgg ggaccggatt gctggcagtg       780
     gtagggatca aactgccggg gctggagttt aaaaaccagc gtgtagaggc tgcctaccgt       840
     aaagagctgg tttatggtga agacgatgcc acgcgcgcga cgccgcctac ggtacgcgag       900
     ctgtttagcg ccgtacggaa aaactatttc cgcctctatt ttcactatat gtatttcaac       960
     atcgcccgca ttctctattt gcaggtcgat aacgttttcg gtttgttctt gctgtttccg      1020
     tcaattgttg ccggtacgat tacgctcggc ctgatgacgc agattaccaa cgtttttggt      1080
     caggttcgcg gtgctttcca gtacctgatt aactcatgga ccacactggt tgagttgatg      1140
     tctatctaca aacgtctgcg cagctttgaa catgagctgg atggtgacaa aattcaggaa      1200
     gtaacccata ccttgagcta a                                                1221
//

If you have problems or comments...

PBIL Back to PBIL home page