(data stored in ACNUC7421 zone)

EMBL: CP001509.SDHA

CP001509.SDHA        Location/Qualifiers
FT   CDS_pept        714477..716243
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sdhA"
FT                   /locus_tag="ECD_00683"
FT                   /product="succinate dehydrogenase, flavoprotein subunit"
FT                   /note="similar to b0723"
FT                   /db_xref="EnsemblGenomes-Gn:ECD_00683"
FT                   /db_xref="EnsemblGenomes-Tr:ACT42558"
FT                   /protein_id="ACT42558.1"
FT                   /translation="MKLPVREFDAVVIGAGGAGMRAALQISQSGQTCALLSKVFPTRSH
FT                   TVSAQGGITVALGNTHEDNWEWHMYDTVKGSDYIGDQDAIEYMCKTGPEAILELEHMGL
FT                   PFSRLDDGRIYQRPFGGQSKNFGGEQAARTAAAADRTGHALLHTLYQQNLKNHTTIFSE
FT                   WYALDLVKNQDGAVVGCTALCIETGEVVYFKARATVLATGGAGRIYQSTTNAHINTGDG
FT                   VGMAIRAGVPVQDMEMWQFHPTGIAGAGVLVTEGCRGEGGYLLNKHGERFMERYAPNAK
FT                   DLAGRDVVARSIMIEIREGRGCDGPWGPHAKLKLDHLGKEVLESRLPGILELSRTFAHV
FT                   DPVKEPIPVIPTCHYMMGGIPTKVTGQALTVNEKGEDVVVPGLFAVGEIACVSVHGANR
FT                   LGGNSLLDLVVFGRAAGLHLQESIAEQGALRDASESDVEASLDRLNRWNNNRNGEDPVA
FT                   IRKALQECMQHNFSVFREGDAMAKGLEQLKVIRERLKNARLDDTSSEFNTQRVECLELD
FT                   NLMETAYATAVSANFRTESRGAHSRFDFPDRDDENWLCHSLYLPESESMTRRSVNMEPK
FT                   LRPAFPPKIRTY"
     atgaaattgc cagtcagaga atttgatgca gttgtgattg gtgccggcgg cgcaggtatg        60
     cgcgcggcgc tgcaaatttc ccagagcggc cagacctgtg cgctgctctc taaagtcttc       120
     ccgacccgtt cccataccgt ttctgcgcaa ggcggcatta ccgttgcgct gggtaatacc       180
     catgaagata actgggaatg gcatatgtac gacaccgtaa aagggtcgga ctatatcggt       240
     gaccaggacg cgattgaata tatgtgtaaa accgggccgg aagcgattct ggaactcgaa       300
     cacatgggcc tgccgttctc gcgtcttgat gatggtcgta tctatcaacg tccgtttggc       360
     ggtcagtcga aaaacttcgg cggcgagcag gcggcacgca ctgcggcagc ggctgaccgt       420
     accggtcacg cactgttgca cacgctttat cagcagaacc tgaaaaacca caccaccatt       480
     ttctccgagt ggtatgcgct ggatctggtg aaaaaccagg atggcgcggt ggtgggttgt       540
     accgcactgt gcatcgaaac cggtgaagtg gtttatttca aagcccgcgc taccgtgctg       600
     gcgactggcg gggcagggcg tatttatcag tccaccacta acgcccacat taacactggc       660
     gacggtgtcg gcatggctat ccgcgcaggc gtaccggtgc aggatatgga aatgtggcaa       720
     ttccacccga ccggcattgc cggtgcgggc gtactggtca ccgaaggttg ccgtggtgaa       780
     ggcggttatc tgctgaacaa acatggcgaa cgctttatgg agcgttatgc gccgaacgcc       840
     aaagacctgg cgggccgtga tgtggtggcg cgttccatca tgattgaaat ccgtgaaggt       900
     cgcggctgtg atggtccgtg ggggccacac gcgaaactga aactcgatca cctgggtaaa       960
     gaagttctcg aatcccgtct gccgggtatc ctggagcttt cccgtacctt cgctcacgtt      1020
     gatccggtga aagagccgat tccggttatc ccaacctgtc actacatgat gggcggtatt      1080
     ccgaccaaag tgaccggtca ggcgctgact gtgaatgaga aaggcgaaga tgtggttgtt      1140
     ccggggctgt tcgcggtagg tgaaattgcc tgcgtatcgg tacacggtgc taaccgtctg      1200
     ggcggtaact cgctgctgga cctggtggtc tttggtcgcg cagcgggtct gcatctgcaa      1260
     gagtctatcg ccgagcaggg cgcattgcgc gatgccagcg agtctgatgt tgaagcatct      1320
     ctggatcgtc tgaaccgctg gaacaataat cgtaacggtg aagatccggt ggcgattcgt      1380
     aaagcgctgc aagaatgtat gcagcataac ttctcggtct tccgtgaagg tgatgcgatg      1440
     gcgaaagggc ttgagcagtt gaaagttatc cgcgagcgtc tgaaaaatgc ccgtctggat      1500
     gacacttcca gcgagttcaa cacccagcgc gttgagtgtc tggaactgga taacctgatg      1560
     gaaacggcgt atgcaacggc tgtttctgcc aacttccgta ccgaaagccg tggcgcgcat      1620
     agccgcttcg acttcccgga tcgtgatgat gaaaactggc tgtgccactc cctgtatctg      1680
     ccagagtcgg aatccatgac gcgccgaagc gtcaacatgg aaccgaaact gcgcccggca      1740
     ttcccgccga agattcgtac ttactaa                                          1767
//

If you have problems or comments...

PBIL Back to PBIL home page