(data stored in ACNUC7421 zone)

EMBL: CP001509.SDHB

CP001509.SDHB        Location/Qualifiers
FT   CDS_pept        716259..716975
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sdhB"
FT                   /locus_tag="ECD_00684"
FT                   /product="succinate dehydrogenase, FeS subunit"
FT                   /note="similar to b0724"
FT                   /db_xref="EnsemblGenomes-Gn:ECD_00684"
FT                   /db_xref="EnsemblGenomes-Tr:ACT42559"
FT                   /protein_id="ACT42559.1"
FT                   /translation="MRLEFSIYRYNPDVDDAPRMQDYTLEAEEGRDMMLLDALIQLKEK
FT                   DPSLSFRRSCREGVCGSDGLNMNGKNGLACITPISALNQPGKKIVIRPLPGLPVIRDLV
FT                   VDMGQFYAQYEKIKPYLLNNGQNPPAREHLQMPEQREKLDGLYECILCACCSTSCPSFW
FT                   WNPDKFIGPAGLLAAYRFLIDSRDTETGSRLDGLSDAFSVFRCHSIMNCVSVCPKGLNP
FT                   TRAIGHIKSMLLQRNA"
     atgagactcg agttttcaat ttatcgctat aacccggatg ttgatgatgc tccgcgtatg        60
     caggattaca ccctggaagc ggaagaaggt cgcgacatga tgttgctgga tgcgcttatc       120
     cagctgaaag agaaagatcc cagcctgtcg ttccgccgct cctgccgtga aggtgtgtgc       180
     ggttccgacg gtctgaacat gaacggcaag aatggtctgg cctgtattac cccgatttcg       240
     gcactcaacc agccgggcaa gaagattgtg attcgcccgc tgccaggttt accggtgatc       300
     cgcgatttgg tggtagacat gggacaattc tatgcgcaat atgagaaaat taagccttac       360
     ctgttgaata atggacaaaa tccgccagct cgcgagcatt tacagatgcc agagcagcgc       420
     gaaaaactcg acgggctgta tgaatgtatt ctctgcgcat gttgttcaac ctcttgtccg       480
     tctttctggt ggaatcccga taagtttatc ggcccggcag gcttgttagc ggcatatcgt       540
     ttcctgatcg atagccgtga taccgagact ggcagccgcc tcgacggttt gagcgatgca       600
     ttcagtgtat tccgctgtca cagcatcatg aactgcgtca gtgtatgtcc gaaggggctg       660
     aacccgacgc gcgccatcgg ccatatcaag tcgatgttgt tgcagcgtaa tgcgtaa          717
//

If you have problems or comments...

PBIL Back to PBIL home page