(data stored in ACNUC7421 zone)

EMBL: CP001509.SECD

CP001509.SECD        Location/Qualifiers
FT   CDS_pept        393049..394896
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="secD"
FT                   /locus_tag="ECD_00356"
FT                   /product="SecYEG protein translocase auxillary subunit"
FT                   /note="similar to b0408"
FT                   /db_xref="EnsemblGenomes-Gn:ECD_00356"
FT                   /db_xref="EnsemblGenomes-Tr:ACT42255"
FT                   /protein_id="ACT42255.1"
FT                   /translation="MLNRYPLWKYVMLIVVIVIGLLYALPNLFGEDPAVQITGARGVAA
FT                   SEQTLIQVQKTLQEEKITAKSVALEEGAILARFDSTDTQLRAREALMGVMGDKYVVALN
FT                   LAPATPRWLAAIHAEPMKLGLDLRGGVHFLMEVDMDTALGKLQEQNIDSLRSDLREKGI
FT                   PYTTVRKENNYGLSITFRDAKARDEAIAYLSKRHPDLVISSQGSNQLRAVMSDARLSEA
FT                   REYAVQQNINILRNRVNQLGVAEPVVQRQGADRIVVELPGIQDTARAKEILGATATLEF
FT                   RLVNTNVDQAAAASGRVPGDSEVKQTREGQPVVLYKRVILTGDHITDSTSSQDEYNQPQ
FT                   VNISLDSAGGNIMSNFTKDNIGKPMATLFVEYKDSGKKDANGRAVLVKQEEVINIANIQ
FT                   SRLGNSFRITGINNPNEARQLSLLLRAGALIAPIQIVEERTIGPTLGMQNIEQGLEACL
FT                   AGLLVSILFMIIFYKKFGLIATSALIANLILIVGIMSLLPGATLSMPGIAGIVLTLAVA
FT                   VDANVLINERIKEELSNGRTVQQAIDEGYRGAFSSIFDANITTLIKVIILYAVGTGAIK
FT                   GFAITTGIGVATSMFTAIVGTRAIVNLLYGGKRVKKLSI"
     gtgttaaacc gttatccttt gtggaagtac gtcatgctga tcgtggtgat tgtcatcggt        60
     ctgctgtatg cgcttcccaa cctgtttggt gaggatccgg ctgttcagat cactggtgcg       120
     cgcggagtcg ccgccagtga gcaaacgctg atccaggtcc agaaaacgtt acaagaagaa       180
     aaaataactg ctaagtctgt ggcactggaa gagggcgcta ttcttgcgcg cttcgactcc       240
     actgacaccc agttgcgcgc tcgtgaagca ttaatgggcg ttatgggtga caaatacgtc       300
     gtggcgctta accttgcccc ggcaacgccg cgctggctgg cagctattca cgctgagccg       360
     atgaagctcg gccttgacct gcgtggcggc gttcacttcc tgatggaagt ggatatggac       420
     accgcgcttg gcaaactcca ggaacaaaat atcgatagcc tacgcagtga cctgcgcgaa       480
     aagggcatcc cgtataccac tgttcgtaaa gaaaacaact acggcctgag catcactttc       540
     cgcgatgcta aagctcgtga tgaagccatt gcgtatctga gcaagcgcca tccggacctg       600
     gtgattagca gccagggcag caaccagctg cgtgcggtaa tgagcgatgc tcgtctgagt       660
     gaagcgcgtg aatatgcggt gcagcagaac attaatatcc tgcgtaaccg tgtaaaccaa       720
     cttggcgtgg cggagccggt ggttcagcgt cagggtgctg accgtatcgt tgttgaactg       780
     ccaggtattc aggacactgc gcgtgcgaaa gagattctgg gtgcgacggc aacgctggaa       840
     ttccgtctgg taaacaccaa cgttgaccag gccgctgcgg catccggtcg cgtaccgggc       900
     gactctgaag tgaaacagac ccgcgaaggt cagccagttg tgctgtacaa acgcgtaatt       960
     ctgaccggtg accatatcac cgactccact tccagccagg acgaatacaa ccaaccgcag      1020
     gttaacatct cgctcgatag cgctggtggt aacatcatgt ctaacttcac taaggacaac      1080
     atcggcaaac cgatggcaac cctgtttgtg gagtacaaag acagcggtaa gaaagatgca      1140
     aatggtcgtg cggttctggt gaaacaggaa gaggtgatta acatcgccaa catccagtct      1200
     cgtctgggta acagcttccg tatcaccggc atcaacaacc cgaacgaagc ccgtcagctg      1260
     tcactgctgc tgcgtgccgg tgcgttgatc gcgccgattc agattgttga agaacgtacc      1320
     attggcccaa ccctgggtat gcagaacatt gaacaggggc tggaggcttg ccttgccggt      1380
     ctgctggttt ctattctgtt catgatcatc ttctataaga agtttggtct gattgcgacc      1440
     agtgctctga ttgccaactt gatcttaatc gtcggcatta tgtcgctgtt gccaggcgca      1500
     acgctgagta tgccaggtat cgcgggtatc gtcttaaccc ttgcggtggc ggtcgatgcg      1560
     aacgtactga tcaacgaacg tattaaagaa gagttgagca acggacgtac tgttcaacag      1620
     gcaattgatg aaggttatcg tggcgcattc agttctatct tcgatgcgaa catcaccacg      1680
     ctgattaaag tcatcatcct gtacgcagtg ggtaccgggg caattaaagg gttcgcgatt      1740
     actaccggta tcggtgtggc gacgtcgatg tttaccgcga ttgtcggtac gcgtgccatc      1800
     gtaaacctgc tatatggcgg caagcgcgtc aagaagctgt caatctga                   1848
//

If you have problems or comments...

PBIL Back to PBIL home page