(data stored in ACNUC7421 zone)

EMBL: CP001509.SECF

CP001509.SECF        Location/Qualifiers
FT   CDS_pept        394907..395878
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="secF"
FT                   /locus_tag="ECD_00357"
FT                   /product="SecYEG protein translocase auxillary subunit"
FT                   /note="similar to b0409"
FT                   /db_xref="EnsemblGenomes-Gn:ECD_00357"
FT                   /db_xref="EnsemblGenomes-Tr:ACT42256"
FT                   /protein_id="ACT42256.1"
FT                   /translation="MAQEYTVEQLNHGRKVYDFMRWDYWAFGISGLLLIAAIVIMGVRG
FT                   FNWGLDFTGGTVIEITLEKPAEIDVMRDALQKAGFEEPMLQNFGSSHDIMVRMPPAEGE
FT                   TGGQVLGSQVLKVINESTNQNAAVKRIEFVGPSVGADLAQTGAMALMAALLSILVYVGF
FT                   RFEWRLAAGVVIALAHDVIITLGILSLFHIEIDLTIVASLMSVIGYSLNDSIVVSDRIR
FT                   ENFRKIRRGTPYEIFNVSLTQTLHRTLITSGTTLMVILMLYLFGGPVLEGFSLTMLIGV
FT                   SIGTASSIYVASALALKLGMKREHMLQQKVEKEGADQPSILP"
     gtggcacagg aatatactgt tgaacaacta aaccacggcc gtaaagtcta tgactttatg        60
     cgctgggact actgggcttt cggcatctct ggtctgctgt taatcgctgc tatcgttatt       120
     atgggcgtgc gcggctttaa ctgggggctg gatttcaccg gtggtacggt tattgaaatt       180
     acgctcgaaa aaccggctga aattgacgta atgcgtgatg cattgcaaaa agccggtttt       240
     gaagagccga tgctgcaaaa ctttggtagc agccatgaca tcatggtccg tatgccgcct       300
     gctgaaggcg aaaccggcgg tcaggtgttg ggcagccagg ttctgaaggt gattaacgaa       360
     tccaccaatc agaatgcagc agtgaagcgt attgagttcg tcggtccgag cgtgggggca       420
     gaccttgcgc aaaccggtgc gatggcgttg atggcagcgc tgctgtctat cctcgtgtac       480
     gtaggtttcc gctttgagtg gcgactggcg gcaggggtgg ttattgcgct ggcgcacgac       540
     gttatcatta cgctgggtat tttgtcgtta ttccatatcg agattgacct gaccattgtg       600
     gcatcgttga tgtcggttat cggttactcg cttaacgaca gtatcgtggt atcggaccgt       660
     attcgtgaaa acttccgcaa gatccgtcgc ggtacgcctt acgaaatctt taacgtgtcc       720
     ttgacccaga cgctgcaccg taccttgatc acatccggta ctaccttgat ggttatcctg       780
     atgctgtacc tcttcggtgg tccggtactg gaaggcttct cgctgaccat gcttatcggt       840
     gtttccatcg gtactgcatc ttccatctat gtggcatctg cgttggctct gaaactgggt       900
     atgaagcgcg aacacatgtt gcagcagaaa gtggaaaaag aaggggcgga tcagccgtca       960
     attctgccgt aa                                                           972
//

If you have problems or comments...

PBIL Back to PBIL home page