(data stored in ACNUC7421 zone)

EMBL: CP001509.SFMD

CP001509.SFMD        Location/Qualifiers
FT   CDS_pept        528784..531393
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sfmD"
FT                   /locus_tag="ECD_00482"
FT                   /product="putative outer membrane export usher protein"
FT                   /note="similar to b0532"
FT                   /db_xref="EnsemblGenomes-Gn:ECD_00482"
FT                   /db_xref="EnsemblGenomes-Tr:ACT42381"
FT                   /protein_id="ACT42381.1"
FT                   /translation="MKIPTTTDIPQRYTWCLAGICYSSLAILPSFLSYAESYFNPAFLL
FT                   ENGTSVADLSRFERGNHQPAGVYRVDLWRNDEFIGSQDIVFESTTENTGDKSGGLMPCF
FT                   NQVLLERIGLNSSAFPELAQQQNNKCINLLKAVPDATINFDFAAMRLNITIPQIALLSS
FT                   AHGYIPPEEWDEGIPALLLNYNFTGNRGNGNDSYFFSELSGINIGPWRLRNNGSWNYFR
FT                   GNGYHSEQWNNIGTWVQRAIIPLKSELVMGDGNTGSDIFDGVGFRGVRLYSSDNMYPDS
FT                   QQGFAPTVHGIARTAAQLTIRQNGFIIYQSYVSPGAFEITDLHPTSSNGDLDVTIDERD
FT                   GNQQNYTIPYSTVPILQREGRFKFDLTAGDFRSGNSQQSSPFFFQGTALGGLPQEFTAY
FT                   GGTQLSANYTAFLLGLGRNLGNWGAVSLDVTHARSQLADDSRHEGDSIRFLYAKSMNTF
FT                   GTNFQLMGYRYSTQGFYTLDDVAYRRMEGYEYDYDYDGEHRDEPIIVNYHNLRFSRKDR
FT                   LQLNISQSLNDFGSLYISGTHQKYWNTSDSDTWYQVGYTSSWVGISYSLSFSWNESVGI
FT                   PDNERIVGLNVSVPFNVLTKRRYTRENALDRAYASFNANRNSNGQNSWLAGVGGTLLEG
FT                   HNLSYHVSQGDTSNNGYTGSATANWQAAYGTLGVGYNYDRDQHDVNWQLSGGVVGHENG
FT                   ITLSQPLGDTNVLIKAPGAGGVRIENQTGILTDWRGYAVMPYATVYRYNRIALDTNTMG
FT                   NSIDVEKNISSVVPTQGALVRANFDTRIGVRALITVTQGGKPVPFGSLVRENSTGITSM
FT                   VGDDGQVYLSGAPLSGELLVQWGDGANSRCIAHYVLPKQSLQQAVTVISAVCTHPGS"
     atgaaaatac ccactactac ggatattccg cagaggtata cctggtgtct ggccggaatt        60
     tgttattcat ctcttgccat tttaccctcc tttttaagct atgcggaaag ttatttcaac       120
     ccggcatttt tattagagaa tggcacatcc gttgctgatt tatcgcgctt tgagagaggt       180
     aatcatcaac ctgcgggcgt gtatcgggtg gatctctggc gtaatgatga gttcattggt       240
     tcgcaggata tcgtatttga atcgacaaca gaaaatacag gtgataaatc aggtgggtta       300
     atgccctgtt ttaaccaggt acttcttgaa cgaattggcc ttaatagcag tgcatttccc       360
     gagttagccc agcagcaaaa caataaatgc atcaatttac tgaaagctgt acctgatgcc       420
     acaattaact ttgattttgc agcgatgcgc ctgaacatca ctattcctca gatagcgttg       480
     ttgagtagcg ctcacggtta cattccgcct gaagagtggg atgaaggtat tcctgcttta       540
     ctcctgaatt ataatttcac cggtaacaga ggtaatggta acgatagcta tttttttagt       600
     gagctcagcg ggattaatat tggcccgtgg cgtttacgca acaatggttc ctggaactat       660
     tttcgcggaa atggatatca ttcagaacag tggaataata ttggcacctg ggtacagcgc       720
     gccattattc cgctgaaaag tgaactggta atgggagacg gcaatacagg aagtgatatt       780
     ttcgatggcg ttggatttcg tggtgtacgg ctttattctt ctgataatat gtatcctgat       840
     agccagcaag ggtttgcccc aacggtacat gggattgccc gtacggcggc ccagctaacg       900
     attcggcaaa atggttttat tatctatcaa agctatgttt cccccggcgc ttttgaaatt       960
     acagatttgc acccgacatc ttcaaatggc gatctggacg tcaccatcga cgagcgcgat      1020
     ggcaatcagc agaattacac aattccgtat tcaacagtgc caattttaca acgcgaaggg      1080
     cgtttcaaat ttgatctgac ggcgggcgat tttcgtagcg gtaatagtca gcaatcatca      1140
     cctttctttt ttcagggcac ggcactcggt ggtttaccac aggaatttac tgcctacggc      1200
     gggacgcaat tatctgccaa ttacaccgcc tttttgttag ggctggggcg caacctcggg      1260
     aactggggcg cagtgtcgct ggatgtaacg catgcgcgca gtcagttagc cgacgacagt      1320
     cgtcatgagg gggattccat tcgcttcctc tatgcgaaat caatgaacac cttcggcacc      1380
     aattttcagt taatgggtta ccgctattcg acacaaggtt tttataccct tgatgatgtt      1440
     gcgtatcgtc gaatggaggg gtacgaatat gattacgatt acgacggtga gcatcgcgat      1500
     gaaccgataa tcgtgaatta ccacaattta cgctttagcc gtaaagaccg tttgcagtta      1560
     aatatttcac aatcacttaa tgactttggc tcgctttata tctctggtac ccatcaaaaa      1620
     tactggaata cttcggattc agatacgtgg tatcaggtgg ggtataccag cagctgggtt      1680
     ggcatcagtt attcgctctc attttcgtgg aatgaatctg tagggatccc cgataacgaa      1740
     cgtattgtcg gacttaatgt ttcagtgcct ttcaatgttt tgaccaaacg tcgctacacc      1800
     cgggaaaatg cgctcgaccg cgcttatgcc tcctttaacg ccaaccgtaa cagcaacggg      1860
     caaaatagct ggctggcagg tgtaggtggg accttactgg aaggccacaa cctgagttat      1920
     cacgtaagcc agggtgatac ctcgaataat gggtacacgg gcagcgccac ggcaaactgg      1980
     caggccgctt acggtacgct gggggtcggg tataactacg accgcgatca acatgacgtt      2040
     aactggcagc tgtctggcgg tgtggtcggg catgaaaatg gcataacgct gagccagcct      2100
     ttaggggata ccaatgtttt gattaaagca cctggcgcag gcggtgtacg cattgaaaat      2160
     caaactggca ttttaactga ctggcgcggc tatgcggtga tgccgtatgc cacggtttat      2220
     cggtataacc gtatcgcgct tgataccaat acgatgggga attccatcga tgttgaaaaa      2280
     aatattagca gcgttgtgcc gacgcaaggc gcgttggttc gtgccaattt tgatacccgc      2340
     ataggcgtgc gggcgctcat taccgttacc cagggcggaa aaccggtgcc gtttggatca      2400
     ctggtacggg aaaacagtac cggaataacc agtatggtgg gtgatgacgg gcaagtttat      2460
     ttaagtggtg cgccattgtc tggtgaatta ctggttcagt ggggagacgg cgcgaactca      2520
     cgctgcattg cgcactatgt attgccgaag caaagcttac agcaagccgt cactgttatt      2580
     tcggcagttt gcacacatcc tggctcataa                                       2610
//

If you have problems or comments...

PBIL Back to PBIL home page