(data stored in ACNUC7421 zone)

EMBL: CP001509.SFMZ

CP001509.SFMZ        Location/Qualifiers
FT   CDS_pept        complement(532941..533573)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sfmZ"
FT                   /locus_tag="ECD_00485"
FT                   /product="response regulator family protein"
FT                   /note="similar to b0535"
FT                   /db_xref="EnsemblGenomes-Gn:ECD_00485"
FT                   /db_xref="EnsemblGenomes-Tr:ACT42384"
FT                   /protein_id="ACT42384.1"
FT                   /translation="MKPTSVIIMDTHPIIRMSIEVLLQKNSELQIVLKTDDYRITIDYL
FT                   RTRPVDLIIMDIDLPGTDGFTFLKRIKQIQSTVKVLFLSSKSECFYAGRAIQAGANGFV
FT                   SKCNDQNDIFHAVQMILSGYTFFPSETLNYIKSNKCSTNSSTITVLSNREVTILRYLVS
FT                   GLSNKEIADKLLLSNKTVSAHKSNIYGKLGLHSIVELIDYAKLYELI"
     atgaaaccaa cgtcggtgat cattatggat actcatccta tcatcagaat gtctattgaa        60
     gttctgttgc aaaaaaacag tgaattgcag attgtcctga aaacggatga ttaccgcata       120
     accatcgatt atctccgaac ccgtcctgtt gatttaatca ttatggatat agacttgccc       180
     ggaacagacg gttttacctt cctgaaaagg atcaaacaaa tccagagcac agtgaaagtg       240
     ttatttttat catcgaaatc agaatgcttt tatgctggca gagcgataca agctggtgct       300
     aacggttttg tcagtaaatg caatgatcag aatgatattt ttcatgccgt tcagatgatc       360
     ctctccggat acacgttttt tcctagcgaa acgcttaact atataaaaag caataaatgt       420
     agtacgaata gttcaacgat cactgtgcta tctaatcgtg aagtgaccat attacgttat       480
     ctggttagcg gattatctaa taaagaaatt gccgataagt tattacttag caataaaaca       540
     gttagtgcgc ataaatctaa tatttatggc aagctaggtt tgcattcaat tgtagagctt       600
     atcgactacg ccaaattata tgaattaata taa                                    633
//

If you have problems or comments...

PBIL Back to PBIL home page