(data stored in ACNUC7421 zone)

EMBL: CP001509.SUCD

CP001509.SUCD        Location/Qualifiers
FT   CDS_pept        722841..723710
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sucD"
FT                   /locus_tag="ECD_00688"
FT                   /product="succinyl-CoA synthetase, NAD(P)-binding, alpha
FT                   subunit"
FT                   /EC_number="6.2.1.5"
FT                   /note="similar to b0729"
FT                   /db_xref="EnsemblGenomes-Gn:ECD_00688"
FT                   /db_xref="EnsemblGenomes-Tr:ACT42563"
FT                   /protein_id="ACT42563.1"
FT                   /translation="MSILIDKNTKVICQGFTGSQGTFHSEQAIAYGTKMVGGVTPGKGG
FT                   TTHLGLPVFNTVREAVAATGATASVIYVPAPFCKDSILEAIDAGIKLIITITEGIPTLD
FT                   MLTVKVKLDEAGVRMIGPNCPGVITPGECKIGIQPGHIHKPGKVGIVSRSGTLTYEAVK
FT                   QTTDYGFGQSTCVGIGGDPIPGSNFIDILEMFEKDPQTEAIVMIGEIGGSAEEEAAAYI
FT                   KEHVTKPVVGYIAGVTAPKGKRMGHAGAIIAGGKGTADEKFAALEAAGVKTVRSLADIG
FT                   EALKTVLK"
     atgtccattt taatcgataa aaacaccaag gttatctgcc agggctttac cggtagccag        60
     gggactttcc actcagaaca ggccattgca tacggcacta aaatggttgg tggcgtaact       120
     ccaggtaaag gcggcactac ccacctcggc ctgccggtgt tcaacaccgt gcgtgaagct       180
     gttgctgcta ctggcgctac cgcttctgtt atctacgtac cagcaccgtt ctgcaaagac       240
     tccattctgg aagccatcga cgcaggcatc aaactgatta tcaccatcac tgaaggcatc       300
     ccgacgctgg atatgctgac tgtgaaagtg aaactggacg aagcaggcgt tcgtatgatc       360
     ggcccgaact gcccaggcgt tatcactccg ggtgaatgca aaatcggtat ccagccgggt       420
     cacattcaca aaccgggtaa agtgggtatc gtttcccgtt ccggtacact gacctatgaa       480
     gcggttaaac agaccacgga ttacggtttc ggtcagtcga cctgtgtcgg tatcggcggt       540
     gacccgatcc ctggctctaa ctttatcgac attctcgaaa tgttcgaaaa agatccgcag       600
     accgaagcga tcgtgatgat tggtgagatc ggcggtagcg ctgaagaaga agcggcagcg       660
     tacatcaaag agcacgttac caagccagtt gtgggctaca ttgctggtgt gactgcgccg       720
     aaaggcaaac gtatgggcca cgcgggtgcc atcattgccg gtgggaaagg gactgcggat       780
     gagaaattcg ctgctctgga agccgcaggc gtgaaaaccg ttcgcagcct ggcggatatc       840
     ggtgaagcac tgaaaactgt tctgaaataa                                        870
//

If you have problems or comments...

PBIL Back to PBIL home page