(data stored in ACNUC7421 zone)

EMBL: CP001509.TAUA

CP001509.TAUA        Location/Qualifiers
FT   CDS_pept        351119..352081
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tauA"
FT                   /locus_tag="ECD_00315"
FT                   /product="taurine ABC transporter periplasmic binding
FT                   protein"
FT                   /note="similar to b0365"
FT                   /db_xref="EnsemblGenomes-Gn:ECD_00315"
FT                   /db_xref="EnsemblGenomes-Tr:ACT42214"
FT                   /protein_id="ACT42214.1"
FT                   /translation="MAISSRNTLLAALAFIAFQAQAVNVTVAYQTSAEPAKVAQADNTF
FT                   AKESGATVDWRKFDSGASIVRALASGDVQIGNLGSSPLAVAASQQVPIEVFLLASKLGN
FT                   SEALVVKKTISKPEDLIGKRIAVPFISTTHYSLLAALKHWGIKPGQVEIVNLQPPAIIA
FT                   AWQRGDIDGAYVWAPAVNALEKDGKVLTDSEQVGQWGAPTLDVWVVRKDFAEKHPEVVK
FT                   AFAKSAIDAQQPYIANPDAWLKQPENISKLARLSGVPEGDVPGLVKGNTYLTPQQQTAE
FT                   LTGPVNKAIIDTAQFLKEQGKVPAVANDYSQYVTSRFVQ"
     atggcaattt catcgcgaaa cacacttctt gccgcactgg cattcatcgc ttttcaggca        60
     caggcggtga acgtcaccgt ggcgtatcaa acctcagccg aaccggcgaa agtggctcag       120
     gccgacaaca cctttgctaa agaaagcgga gcaaccgtgg actggcgtaa gtttgacagc       180
     ggagccagca tcgtgcgggc gctggcttct ggcgacgtgc aaatcggcaa ccttggttcc       240
     agcccgttag cggttgcagc cagccaacag gtgccgattg aagtcttctt gctggcgtca       300
     aaactgggta actcagaagc gctggtggta aagaaaacta tcagcaaacc ggaagatctg       360
     attggcaaac gcatcgccgt accgtttatc tctaccaccc actacagcct gctggcagcg       420
     ctgaaacact ggggcattaa acctgggcaa gtggagattg tgaacctgca gccgcccgcg       480
     attatcgctg catggcagcg gggagatatt gatggtgctt atgtctgggc accggcggtt       540
     aacgccctgg aaaaagacgg caaagtgctg accgattctg aacaggtcgg gcagtggggt       600
     gcgccaacgc tggacgtctg ggtggtgcgc aaagattttg ccgagaaaca tcctgaggtg       660
     gtgaaagcgt tcgccaaaag cgccatcgat gctcagcaac cgtacattgc taacccagac       720
     gcgtggctga aacagccgga aaacatcagc aaactggcgc ggttaagcgg cgtgcctgaa       780
     ggtgacgttc cggggctggt gaaggggaat acctatctga cgccgcagca acaaacggca       840
     gaactgaccg gaccggtgaa caaagcgatc atcgacaccg cgcagttttt gaaagagcag       900
     ggcaaggtcc cggctgtagc gaatgattac agccagtacg ttacctcgcg cttcgtgcaa       960
     taa                                                                     963
//

If you have problems or comments...

PBIL Back to PBIL home page