(data stored in ACNUC7421 zone)

EMBL: CP001509.THIL

CP001509.THIL        Location/Qualifiers
FT   CDS_pept        401035..402012
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="thiL"
FT                   /locus_tag="ECD_00365"
FT                   /product="thiamine monophosphate kinase"
FT                   /EC_number="2.7.4.16"
FT                   /note="similar to b0417"
FT                   /db_xref="EnsemblGenomes-Gn:ECD_00365"
FT                   /db_xref="EnsemblGenomes-Tr:ACT42264"
FT                   /protein_id="ACT42264.1"
FT                   /translation="MACGEFSLIARYFDRVRSSRLDVELGIGDDCALLNIPEKQTLAIS
FT                   TDTLVAGNHFLPDIDPADLAYKALAVNLSDLAAMGADPAWLTLALTLPDVDEAWLESFS
FT                   DSLFDLLNYYDMQLIGGDTTRGPLSMTLGIHGFVPMGRALTRSGAKPGDWIYVTGTPGD
FT                   SAAGLAILQNRLQVADAKDADYLIKRHLRPSPRILQGQALRDLANSAIDLSDGLISDLG
FT                   HIVKASDCGARIDLALLPFSDALSRHVEPEQALRWALSGGEDYELCFTVPELNRGALDV
FT                   ALGHLGVPFTCIGQMTADIEGLCFIRDGEPVTLDWKGYDHFATP"
     atggcatgtg gcgagttctc cctgattgcc cgttattttg accgtgtaag aagttctcgt        60
     cttgatgtcg aactgggcat cggcgacgat tgcgcacttc tcaatatccc cgagaaacag       120
     accctggcga tcagcactga tacgctggtg gcgggcaacc acttcctccc tgatatcgat       180
     cctgctgatc tggcgtataa agcactggcg gtgaacctaa gcgatctggc agcgatgggg       240
     gccgatccgg cctggctgac gctggcatta accttgccgg acgtagacga agcgtggctt       300
     gagtccttca gcgacagttt gtttgatctt ctcaattatt acgatatgca actcattggc       360
     ggcgatacca cgcgtgggcc attatcaatg acgttgggta tccacggctt tgttccgatg       420
     ggacgagcct taacgcgctc tggggcgaaa ccgggtgact ggatctatgt gaccggtaca       480
     ccgggcgata gcgccgccgg gctggcgatt ttgcaaaacc gtttgcaggt tgccgatgct       540
     aaagatgctg actacttgat caaacgtcat ctccgtccat cgccgcgtat tttacagggg       600
     caggcactgc gcgatctggc aaattcagct atcgatctct ctgacggtct gatttccgat       660
     ctcgggcata tcgtgaaagc cagcgactgc ggcgcacgta ttgacctggc attgctgccg       720
     ttttctgatg cgctttctcg ccatgttgaa ccggaacagg cgctgcgctg ggcgctctct       780
     ggcggtgaag attacgagtt gtgtttcact gtgccggaac tgaaccgtgg cgcgctggat       840
     gtggctctcg gacacctggg cgtaccgttt acctgtatcg ggcaaatgac cgccgatatc       900
     gaagggcttt gttttattcg tgacggcgaa cctgttacat tagactggaa aggatatgac       960
     cattttgcca cgccataa                                                     978
//

If you have problems or comments...

PBIL Back to PBIL home page