(data stored in ACNUC7421 zone)

EMBL: CP001509.THRB

CP001509.THRB        Location/Qualifiers
FT   CDS_pept        2800..3732
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="thrB"
FT                   /locus_tag="ECD_00003"
FT                   /product="homoserine kinase"
FT                   /EC_number="2.7.1.39"
FT                   /note="similar to b0003"
FT                   /db_xref="EnsemblGenomes-Gn:ECD_00003"
FT                   /db_xref="EnsemblGenomes-Tr:ACT41905"
FT                   /protein_id="ACT41905.1"
FT                   /translation="MVKVYAPASSANMSVGFDVLGAAVTPVDGALLGDVVTVEAAETFS
FT                   LNNLGRFADKLPSEPRENIVYQCWERFCQELGKQIPVAMTLEKNMPIGSGLGSSACSVV
FT                   AALMAMNEHCGKPLNDTRLLALMGELEGRISGSIHYDNVAPCFLGGMQLMIEENDIISQ
FT                   QVPGFDEWLWVLAYPGIKVSTAEARAILPAQYRRQDCIAHGRHLAGFIHACYSRQPELA
FT                   AKLMKDVIAEPYRERLLPGFRQARQAVAEIGAVASGISGSGPTLFALCDKPDTAQRVAD
FT                   WLGKNYLQNQEGFVHICRLDTAGARVLEN"
     atggttaaag tttatgcccc ggcttccagt gccaatatga gcgtcgggtt tgatgtgctc        60
     ggggcggcgg tgacacctgt tgatggtgca ttgctcggag atgtagtcac ggttgaggcg       120
     gcagagacat tcagtctcaa caacctcgga cgctttgccg ataagctgcc gtcagaacca       180
     cgggaaaata tcgtttatca gtgctgggag cgtttttgcc aggagcttgg caagcaaatt       240
     ccagtggcga tgactctgga aaagaatatg ccaatcggtt cgggcttagg ctccagcgcc       300
     tgttcggtgg tcgcggcgct gatggcgatg aatgaacact gtggcaagcc gcttaatgac       360
     actcgtttgc tggctttgat gggcgagctg gaaggacgaa tctccggcag cattcattac       420
     gacaacgtgg caccgtgttt tcttggtggt atgcagttga tgatcgaaga aaacgacatc       480
     atcagccagc aagtgccagg gtttgatgag tggctgtggg tgctggcgta tccggggatt       540
     aaagtctcga cggcagaagc cagggctatt ttaccggcgc agtatcgccg ccaggattgc       600
     attgcgcacg ggcgacatct ggctggcttc attcacgcct gctattcccg tcagcctgag       660
     cttgccgcga agctgatgaa agatgttatc gctgaaccct accgtgaacg gttactgcct       720
     ggcttccggc aggcgcggca ggcggttgcg gaaatcggcg cggtagcgag cggtatctcc       780
     ggctccggcc cgaccttgtt cgctctgtgt gacaagccgg ataccgccca gcgcgttgcc       840
     gactggttgg gtaagaacta cctgcaaaat caggaaggtt ttgttcatat ttgccggctg       900
     gatacggcgg gcgcacgagt actggaaaac taa                                    933
//

If you have problems or comments...

PBIL Back to PBIL home page