(data stored in ACNUC7421 zone)

EMBL: CP001509.TOLA

CP001509.TOLA        Location/Qualifiers
FT   CDS_pept        735003..736268
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tolA"
FT                   /locus_tag="ECD_00699"
FT                   /product="membrane anchored protein in TolA-TolQ-TolR
FT                   complex"
FT                   /note="similar to b0739"
FT                   /db_xref="EnsemblGenomes-Gn:ECD_00699"
FT                   /db_xref="EnsemblGenomes-Tr:ACT42574"
FT                   /protein_id="ACT42574.1"
FT                   /translation="MSKATEQNDKLKRAIIISAVLHVILFAALIWSSFDENIEASAGGG
FT                   GGSSIDAVMVDSGAVVEQYKRMQSQESSAKRSDEQRKMKEQQAAEELREKQAAEQERLK
FT                   QLEKERLAAQEQKKQAEEAAKQAELKQKQAEEAAAKAAADAKAKAEADAKAAEEAAKKA
FT                   AADAKKKAEAEAAKAAAEAQKKAEAAAAALKKKAEAAEAAAAEARKKAATEAAEKAKAE
FT                   AEKKAAAEKAAADKKAAAEKAAADKKAAEKAAAEKAAADKKAAAEKAAADKKAAAAKAA
FT                   AEKAAAAKAAAEADDIFGELSSGKNAPKTGGGAKGNNASPAGSGNTKNNGASGADINNY
FT                   AGQIKSAIESKFYDASSYAGKTCTLRIKLAPDGMLLDIKPEGGDPALCQAALAAAKLAK
FT                   IPKPPSQAVYEVFKNAPLDFKP"
     gtgtcaaagg caaccgaaca aaacgacaag ctcaagcggg cgataattat ttcagcagtg        60
     ctgcatgtca tcttatttgc ggcgctgatc tggagttcgt tcgatgagaa tatagaagct       120
     tcagccggag gcggcggtgg ttcgtccatc gacgctgtca tggttgattc aggtgcggta       180
     gttgagcagt acaaacgcat gcaaagccag gaatcaagcg cgaagcgttc tgatgaacag       240
     cgcaagatga aggaacagca ggctgctgaa gaactgcgtg agaaacaagc ggctgaacag       300
     gaacgcctga agcaacttga gaaagagcgg ttagcggctc aggagcagaa aaagcaggct       360
     gaagaagccg caaaacaggc cgagttaaag cagaagcaag ctgaagaggc ggcagcgaaa       420
     gcggcggcag atgctaaagc gaaggccgaa gcagatgcta aagctgcgga agaagcagcg       480
     aagaaagcgg ctgcagacgc aaagaaaaaa gcagaagcag aagccgccaa agccgcagcc       540
     gaagcgcaga aaaaagccga ggcagccgct gcggcactga agaagaaagc ggaagcggca       600
     gaagcagctg cagctgaagc aagaaagaaa gcggcaactg aagctgctga aaaagccaaa       660
     gcagaagctg agaagaaagc ggctgctgaa aaggctgcag ctgataagaa agcggcagca       720
     gagaaagctg cagccgacaa aaaagcagca gaaaaagcgg ctgctgaaaa ggcagcagct       780
     gataagaaag cagcggcaga aaaagccgcc gcagacaaaa aagcggcagc ggcaaaagct       840
     gcagctgaaa aagccgctgc agcaaaagcg gccgcagagg cagatgatat tttcggtgag       900
     ctaagctctg gtaagaatgc accgaaaacg gggggagggg cgaaagggaa caatgcttcg       960
     cctgccggga gtggtaatac taaaaacaat ggcgcatcag gggccgatat caataactat      1020
     gccgggcaga ttaaatctgc tatcgaaagt aagttctatg acgcatcgtc ctatgcaggc      1080
     aaaacctgta cgctgcgcat aaaactggca cccgatggta tgttactgga tatcaaacct      1140
     gaaggtggcg atcccgcact ttgtcaggct gcgttggcag cagctaaact tgcgaagatc      1200
     ccgaaaccac caagccaggc agtatatgaa gtgttcaaaa acgcgccatt ggacttcaaa      1260
     ccgtaa                                                                 1266
//

If you have problems or comments...

PBIL Back to PBIL home page